Recombinant Anaeromyxobacter dehalogenans Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Glycerol-3-phosphate acyltransferase (PlsY) is an essential enzyme in bacterial lipid metabolism, transferring acyl groups from acyl-phosphate to glycerol-3-phosphate to form lysophosphatidic acid, a precursor for phospholipid synthesis . The recombinant version from Anaeromyxobacter dehalogenans is produced in E. coli with an N-terminal His tag for purification and detection . This enzyme is encoded by the plsY gene (UniProt ID: B8JBQ8 or Q2IH98, depending on the strain) .

Functional Domains

  • Catalytic residues critical for acyltransferase activity .

  • Transmembrane regions for membrane association .

Biochemical Studies

  • Lipid Metabolism: Used to investigate phospholipid biosynthesis pathways in anaerobic bacteria .

  • Enzyme Kinetics: Characterizes substrate specificity and catalytic efficiency .

Bioremediation

  • Anaeromyxobacter species are studied for their metabolic versatility in contaminated environments (e.g., metal reduction, dechlorination) . While PlsY is not directly involved in these processes, its role in membrane integrity supports survival under stress .

Comparative Genomic Insights

  • The plsY gene is conserved among Anaeromyxobacter strains, but its presence varies with metabolic capabilities. For example:

    • Strains 2CP-1 and 2CP-C lack nitrogenase (nif) genes but encode PlsY for lipid synthesis .

    • Diazotrophic strains like PSR-1 and Red267 harbor both plsY and nif clusters .

Catalytic Mechanism

  • PlsY uses a conserved histidine residue for acyl-phosphate binding, confirmed via mutagenesis .

  • Structural modeling predicts a helical bundle fold for substrate interaction .

Industrial Relevance

  • Engineered variants of PlsY are explored for synthesizing bioactive lipids in synthetic biology .

Table 1: Product Variants

VendorCatalog No.HostTagPurityPrice (USD)
Creative BiomartRFL3133AFE. coliHis>90%1,547
CusabioCSB-EP493761E. coliHis>85%1,200

Table 2: Functional Annotations

FeatureDetailSource
Molecular FunctionAcyltransferase activityUniProt
Biological ProcessPhospholipid biosynthetic process
Cellular ComponentCell membrane

Future Directions

  • Structural Resolution: Full crystallographic analysis of PlsY to guide enzyme engineering.

  • Environmental Adaptation: Study PlsY’s role in Anaeromyxobacter survival under redox fluctuations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
plsY; A2cp1_4349; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Target Names
plsY
Target Protein Sequence
MSPDLLGALLVAAGYLAGSIPFGVVLGRLVLGVDVRTVGSGNIGATNVARAGGKKMGVLV LVLDAAKAIVPILVARRVLGGTPHAEFWVTAVAVAAFVGHLFPVWLGFKGGKGVATGLGI FAVLAPWAALAGLVGYAVAYGLTRISSVGSLTGTALCAAGGFATYGPRHPVSWAGLAIAL LIFVRHRENIRRLVRGEEKKV
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is glycerol-3-phosphate acyltransferase (plsY) and what role does it play in bacterial membrane synthesis?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that catalyzes a critical step in bacterial membrane phospholipid biosynthesis. PlsY transfers an acyl group from acylphosphate to glycerol-3-phosphate, initiating phosphatidic acid formation through one of the most widely distributed bacterial biosynthetic pathways. This process works in conjunction with PlsX, which converts acyl-acyl carrier protein to acylphosphate that serves as a substrate for PlsY .

The importance of this enzyme stems from its central role in establishing the structural foundation of bacterial membranes. Current research has determined that PlsY contains multiple membrane-spanning segments with conserved cytoplasmic domains that are essential for its catalytic activity .

What structural features characterize the PlsY enzyme family?

Detailed structural analysis of PlsY from Streptococcus pneumoniae has revealed a distinctive membrane topology characterized by:

  • Five membrane-spanning segments

  • Amino terminus and two short loops located on the external face of the membrane

  • Three larger cytoplasmic domains, each containing highly conserved sequence motifs critical for catalysis

These conserved motifs have specific roles:

  • Motif 1: Contains essential serine and arginine residues

  • Motif 2: Functions as a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site

  • Motif 3: Contains a conserved histidine and asparagine important for activity, plus a glutamate critical to structural integrity

This structural arrangement enables PlsY to properly orient its substrates for efficient catalysis while maintaining its position within the bacterial membrane.

What is known about Anaeromyxobacter dehalogenans biochemistry and ecological significance?

Anaeromyxobacter species, including A. dehalogenans, belong to the class Deltaproteobacteria and are commonly distributed in soil environments, with particular prevalence in paddy soils. These bacteria play significant ecological roles through:

  • Nitrogen fixation capabilities, contributing to nitrogen availability in terrestrial environments

  • Ability to reduce Fe³⁺ to Fe²⁺, demonstrated by color changes in soil slurries (from reddish brown to gray)

  • Growth under anaerobic conditions, allowing them to thrive in oxygen-limited environments

Recent metatranscriptomic analyses have indicated that Anaeromyxobacter is one of the predominant diazotrophs in paddy soils, suggesting its importance in nitrogen cycling in these ecosystems .

Which E. coli expression systems are most appropriate for recombinant production of membrane proteins like Anaeromyxobacter plsY?

Based on comprehensive analysis of recombinant expression systems, several E. coli strains offer advantages for membrane protein expression like plsY:

Expression SystemSupplierKey Benefits for plsY ExpressionApplication
BL21(DE3)pLysSVarious SuppliersLower background expression; better control for potentially toxic membrane proteinsUsed successfully for flavin reductase and arylamine N-acetyltransferase expression
ArcticExpress (DE3)Agilent TechnologiesLow-temperature expression with active chaperones promoting proper folding and increased solubilityEffective for Bis-γ-glutamylcystine expression
OrigamiTM B (DE3)Merck KGaAEnhanced disulfide bond formation in the cytoplasmSuccessfully used for malto-oligosyltrehalose trehalohydrolase
TunerTM(DE3)Merck KGaAPrecisely adjustable inducer concentrations allowing slower protein synthesis to improve solubilityEffectively used for N-Acyl-d-glucosamine 2-epimerase
Rosetta(DE3)Merck KGaAAddresses codon bias issues through supplementary tRNAs for rare codonsDemonstrated success with sphingomyelinase expression

B strain derivatives (particularly BL21 variants) are preferred for enzyme expression in 88% of cases, with BL21(DE3) being the primary choice in 65% of expression studies. Their advantages include deficiency in Lon and OmpT proteases, protecting misfolded proteins from degradation, shorter doubling times, and rapid protein synthesis via the T7 expression system .

What strategies can improve solubility when expressing membrane-bound enzymes like plsY?

Several strategies have proven effective for improving solubility of membrane proteins:

  • Temperature optimization: Lower expression temperatures (15-25°C) can significantly reduce inclusion body formation by slowing protein synthesis and folding rates, allowing more time for proper membrane insertion .

  • Fusion tags: Solubility-enhancing tags such as:

    • Thioredoxin (Trx)

    • Maltose-binding protein (MBP)

    • N-utilization substance A (NusA)

    These tags can dramatically improve solubility when positioned at either terminus of the target protein .

  • Controlled expression: Using expression systems with precisely tunable induction (like TunerTM strains) allows researchers to modulate protein production rates, preventing overwhelming of the cellular machinery .

  • Codon optimization: For proteins containing rare codons, either codon optimization of the gene or using specialized strains supplemented with rare tRNAs (like Rosetta derivatives) can enhance expression .

  • Detergent screening: For membrane proteins like plsY, identifying appropriate detergents for solubilization is critical for maintaining native structure and function during purification.

What methods are available for determining membrane topology of recombinant plsY?

The substituted cysteine accessibility method (SCAM) has proven highly effective for determining the membrane topology of PlsY, as demonstrated with Streptococcus pneumoniae PlsY. This methodology involves:

  • Introduction of cysteine substitutions at various positions throughout the protein sequence

  • Expression of these mutant proteins in an appropriate system

  • Treatment with membrane-impermeable sulfhydryl reagents

  • Analysis of which cysteines are accessible to these reagents

  • Mapping of protein regions exposed to either cytoplasm or external environment

This approach revealed that PlsY possesses five membrane-spanning segments with the amino terminus and two short loops on the external membrane face, while three larger cytoplasmic domains contain the conserved sequence motifs essential for catalytic activity .

Alternative complementary methods include:

  • Fluorescence-based approaches using GFP fusions

  • Protease accessibility studies

  • Epitope insertion analysis

  • Computational prediction algorithms validated by experimental data

How can the enzymatic activity of purified recombinant plsY be measured in vitro?

Several methodological approaches can be employed to measure PlsY activity:

  • Direct assay of acyl transfer: Monitor the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, measuring either:

    • Substrate depletion: Quantifying the decrease in acylphosphate or glycerol-3-phosphate

    • Product formation: Measuring the formation of acylated glycerol-3-phosphate

  • Inhibitor studies: As PlsY is noncompetitively inhibited by palmitoyl-CoA, inhibition studies can validate enzyme identity and provide insight into regulatory mechanisms .

  • Coupled enzyme assays: When direct measurement presents challenges, coupling the PlsY reaction to secondary enzymes with easily detectable products can facilitate analysis.

  • Radiometric assays: Using radiolabeled substrates provides high sensitivity for detecting low levels of enzymatic activity.

  • Detergent considerations: Since PlsY is a membrane protein, activity assays must include appropriate detergents at concentrations that maintain enzyme structure while allowing substrate accessibility.

What site-directed mutagenesis approaches have provided insights into plsY function?

Site-directed mutagenesis studies on PlsY have revealed critical functional domains and residues:

  • Motif 1 mutations:

    • Serine to alanine substitutions eliminated enzymatic activity

    • Arginine residues proved essential for catalysis, likely involved in substrate binding or stabilization of transition states

  • Motif 2 analysis:

    • Glycine to alanine mutations resulted in specific Km defects for glycerol-3-phosphate binding

    • This confirmed Motif 2 as the glycerol-3-phosphate binding site

    • The phosphate-binding loop characteristics suggest a conserved structural arrangement for substrate recognition

  • Motif 3 investigation:

    • Conserved histidine and asparagine residues were identified as important for catalytic activity

    • A critical glutamate residue proved essential for structural integrity rather than directly participating in catalysis

These mutagenesis studies have defined the critical functional architecture of the PlsY enzyme family and provided valuable insights into the catalytic mechanism.

How do environmental conditions affect plsY activity and stability?

While specific data on Anaeromyxobacter dehalogenans PlsY environmental responses is limited, several factors likely influence enzyme activity and stability:

  • Redox conditions: Anaeromyxobacter species thrive under anaerobic conditions and demonstrate Fe³⁺ reduction capabilities, suggesting their enzymes, including PlsY, are adapted to function under low-oxygen environments .

  • Inhibition mechanisms: Studies have shown that PlsY is noncompetitively inhibited by palmitoyl-CoA, indicating metabolic regulation of activity in response to cellular fatty acid levels .

  • Temperature adaptation: As soil-dwelling organisms, Anaeromyxobacter enzymes likely show temperature optima reflective of their environmental niche, with activity profiles potentially differing from model organisms.

  • pH sensitivity: Membrane proteins often demonstrate pH-dependent activity profiles related to proton gradients across membranes and charged residues at active sites.

  • Ionic strength effects: The charged nature of substrates (acylphosphate and glycerol-3-phosphate) suggests ionic strength may significantly impact substrate binding and catalytic efficiency.

How can bioinformatic approaches guide functional characterization of plsY from Anaeromyxobacter dehalogenans?

Bioinformatic analyses offer powerful tools for investigating PlsY structure and function:

  • Sequence analysis across bacterial species can identify:

    • Ultra-conserved residues likely essential for catalysis

    • Variable regions potentially responsible for species-specific differences

    • Evolutionary relationships indicating functional divergence

  • Structural prediction using modern deep learning approaches (AlphaFold, RoseTTAFold) can generate reliable models of Anaeromyxobacter PlsY for:

    • Identifying potential substrate binding pockets

    • Mapping conserved motifs onto 3D structure

    • Predicting effects of mutations on protein stability and function

  • Genomic context analysis examining genes adjacent to plsY can reveal:

    • Potential functional partners in lipid biosynthesis pathways

    • Regulatory elements controlling expression

    • Co-evolution patterns with interacting proteins

  • Comparative analysis with characterized PlsY enzymes (like from S. pneumoniae) can guide targeted experimental design by highlighting common features and unique aspects of the Anaeromyxobacter enzyme.

What challenges arise in crystallizing membrane proteins like plsY and how can they be addressed?

Membrane protein crystallization presents numerous challenges:

  • Detergent selection:

    • Critical for extracting and stabilizing membrane proteins

    • Must maintain native structure while allowing crystal contacts

    • Requires systematic screening of detergent types and concentrations

  • Protein stability:

    • Membrane proteins often show limited stability once removed from lipid environments

    • Addition of lipids or lipid-like molecules can enhance stability

    • Thermostabilizing mutations may improve crystallization prospects

  • Crystal packing:

    • Limited hydrophilic surface area restricts crystal contact formation

    • Fusion partners (like T4 lysozyme) can increase hydrophilic surfaces

    • Antibody fragments can stabilize specific conformations and provide additional crystal contacts

  • Alternative approaches:

    • Lipidic cubic phase crystallization specifically designed for membrane proteins

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystallization

    • Nuclear magnetic resonance (NMR) for structural analysis in membrane-mimetic environments

How can computational modeling contribute to understanding plsY catalytic mechanism?

Computational approaches offer valuable insights into PlsY function:

  • Molecular dynamics simulations can:

    • Model protein behavior in membrane environments

    • Examine substrate binding and product release pathways

    • Identify transient interactions during catalysis

    • Investigate conformational changes upon substrate binding

  • Quantum mechanics/molecular mechanics (QM/MM) methods allow:

    • Detailed modeling of the reaction mechanism

    • Calculation of activation energies for different potential mechanisms

    • Investigation of roles of specific amino acids in catalysis

  • Docking studies enable:

    • Prediction of binding modes for substrates and inhibitors

    • Virtual screening for potential inhibitors

    • Rational design of substrate analogs for mechanistic studies

  • Homology modeling based on related enzymes provides:

    • Structural templates when experimental structures are unavailable

    • Comparison of active site architectures across different species

    • Identification of conserved catalytic machinery

What strategies can resolve expression problems with recombinant Anaeromyxobacter plsY?

When encountering expression difficulties with recombinant PlsY, consider these approaches:

  • Expression strain optimization:

    • Test multiple E. coli strains (BL21 derivatives, C41/C43 specialized for membrane proteins)

    • Consider strains with extra copies of rare tRNAs if codon bias is suspected

    • Evaluate strains with reduced protease activity

  • Induction parameter adjustment:

    • Vary inducer concentration to find optimal expression levels

    • Test different induction temperatures (15-30°C range)

    • Examine various induction durations (2-24 hours)

    • Consider auto-induction media for gradual protein production

  • Vector modifications:

    • Test N-terminal vs. C-terminal tags

    • Evaluate different solubility-enhancing fusion partners

    • Consider codon optimization of the gene sequence

    • Explore vectors with varying promoter strengths

  • Media formulation:

    • Test minimal vs. rich media

    • Evaluate supplementation with membrane components

    • Consider osmolyte addition to stabilize protein folding

How can protein aggregation be minimized during purification of recombinant plsY?

Preventing aggregation during purification requires careful attention to multiple factors:

  • Detergent selection and optimization:

    • Screen multiple detergent classes (maltoside, glucoside, fos-choline derivatives)

    • Test detergent concentration above critical micelle concentration

    • Consider detergent mixtures for improved stability

  • Buffer composition:

    • Optimize pH based on protein properties

    • Include stabilizing agents (glycerol, specific lipids)

    • Test various salt concentrations to minimize aggregation

    • Consider additives like arginine or trehalose that prevent protein-protein interactions

  • Temperature management:

    • Maintain samples at constant, appropriate temperature

    • Avoid freeze-thaw cycles

    • Perform purification steps at reduced temperatures (4°C)

  • Purification strategy:

    • Minimize unnecessary concentration steps

    • Reduce purification time to limit exposure to destabilizing conditions

    • Consider on-column detergent exchange during purification

What approaches can resolve contradictory findings in plsY functional studies?

When faced with contradictory results in PlsY research:

  • Experimental condition standardization:

    • Ensure consistent buffer compositions, pH, and temperature

    • Standardize protein preparation methods

    • Use identical substrate preparations and concentrations

    • Verify enzyme concentration determination methods

  • Method validation:

    • Employ multiple complementary techniques to assess the same parameter

    • Include appropriate positive and negative controls

    • Validate assay sensitivity and specificity

    • Consider time-dependent effects on enzyme activity

  • Sample characterization:

    • Verify protein purity by multiple methods

    • Confirm correct folding through circular dichroism or other structural analyses

    • Assess oligomeric state and homogeneity

    • Determine if post-translational modifications are present

  • Species-specific differences:

    • Recognize that PlsY from different bacterial species may exhibit distinct properties

    • Compare sequences to identify potential structural differences

    • Consider evolutionary adaptations to different cellular environments

What emerging technologies might advance structural studies of membrane proteins like plsY?

Several cutting-edge technologies show promise for membrane protein structural analysis:

  • Cryo-electron microscopy (cryo-EM) advancements:

    • Improved detectors and processing algorithms enabling structure determination of smaller proteins

    • Development of specialized grids for membrane proteins

    • Time-resolved cryo-EM capturing different conformational states

  • Integrative structural biology combining:

    • X-ray crystallography for high-resolution static structures

    • Cryo-EM for conformational ensembles

    • NMR for dynamic information

    • Mass spectrometry for identifying interaction networks

  • Nanodiscs and other membrane mimetics:

    • Improved systems for maintaining membrane proteins in native-like environments

    • Enhanced stability for structural and functional studies

    • Better control over lipid composition to study lipid-protein interactions

  • Computational approaches:

    • AI-based structure prediction specifically optimized for membrane proteins

    • Enhanced molecular dynamics simulations with specialized force fields

    • Improved docking algorithms for membrane protein-ligand interactions

How might plsY be targeted for development of new antimicrobial compounds?

PlsY represents a promising antimicrobial target for several reasons:

  • Essential function:

    • PlsY catalyzes a critical step in membrane phospholipid biosynthesis

    • Inhibition would disrupt bacterial membrane integrity

    • No direct human homolog exists, reducing potential toxicity

  • Structural features favoring inhibitor design:

    • Well-defined active site with essential catalytic residues

    • Three conserved motifs providing multiple targeting opportunities

    • Substrate binding pockets that could accommodate small molecule inhibitors

  • Potential inhibitor approaches:

    • Substrate analogs targeting the acylphosphate or glycerol-3-phosphate binding sites

    • Allosteric inhibitors disrupting essential conformational changes

    • Compounds targeting the membrane-spanning regions to disrupt proper positioning

  • Resistance considerations:

    • Essential nature may reduce likelihood of resistance development

    • Conservation across bacterial species suggests limited tolerance for mutations

    • Understanding of natural inhibitors (like palmitoyl-CoA) provides starting points for inhibitor design

What methodological innovations might improve recombinant expression of challenging membrane proteins?

Several innovative approaches show promise for improving membrane protein expression:

  • Cell-free expression systems:

    • Bypass toxicity issues encountered in living cells

    • Allow direct incorporation into nanodiscs or liposomes

    • Enable rapid screening of expression conditions

    • Facilitate introduction of non-natural amino acids for specialized studies

  • Synthetic biology approaches:

    • Design of specialized expression chassis optimized for membrane proteins

    • Engineering of cellular pathways to enhance membrane insertion machinery

    • Development of synthetic lipids that stabilize specific membrane proteins

  • Machine learning for expression optimization:

    • Predictive models for optimal expression conditions based on protein sequence

    • Systems for identifying beneficial mutations that enhance expression

    • Algorithms for codon optimization specific to membrane proteins

  • Novel fusion systems:

    • Development of specialized tags specifically designed for membrane proteins

    • Self-cleaving fusion partners that improve folding but don't require protease treatment

    • Conditional folding domains that enhance stability without interfering with function

These methodological innovations could significantly advance our ability to produce, purify, and characterize challenging membrane proteins like Anaeromyxobacter dehalogenans PlsY.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.