Recombinant Anaeromyxobacter dehalogenans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Anaeromyxobacter dehalogenans Large-conductance mechanosensitive channel (MscL) refers to the MscL protein produced using recombinant DNA technology, derived from the bacterium Anaeromyxobacter dehalogenans . A. dehalogenans is a bacterium known for its ability to reduce metals and halo-organic compounds, found in diverse environments such as soil and sediments . MscL, or mechanosensitive channel of large conductance, is a type of protein channel that responds to mechanical stimuli, such as changes in membrane tension .

Anaeromyxobacter dehalogenans

Anaeromyxobacter dehalogenans is a bacterium belonging to the delta-Proteobacteria class and is closely related to myxobacteria . It exhibits versatile metabolic capabilities, including anaerobic respiration and the ability to reduce metals such as Fe(III) and U(VI) . Phylogenetic analysis indicates that A. dehalogenans is nested within the Myxococcales order, sharing a closer relation to Myxococcus xanthus than other myxobacteria suborders . Its genome contains genes associated with both aerobic and anaerobic lifestyles, suggesting an evolutionary adaptation from aerobic ancestors .

Large-conductance Mechanosensitive Channel (MscL)

MscL is a membrane protein that functions as a mechanosensitive channel, opening in response to mechanical stimuli such as membrane stretching . These channels are found in various organisms and play a role in protecting cells from osmotic shock by releasing solutes . The MscL from Anaeromyxobacter dehalogenans is a protein with a specific amino acid sequence, and its recombinant form is often used in research .

Recombinant Production

The recombinant form of Anaeromyxobacter dehalogenans MscL is produced using genetic engineering techniques, where the gene encoding the MscL protein is inserted into a host organism (e.g., E. coli) for expression and purification . This allows for the production of large quantities of the protein for research purposes .

Characteristics of Recombinant Anaeromyxobacter dehalogenans MscL

CharacteristicDescription
Product TypeRecombinant Protein
SpeciesAnaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
UniProt Accession No.B8J6V0
Storage BufferTris-based buffer, 50% glycerol, optimized for the protein
Storage ConditionsStore at -20℃; for extended storage, conserve at -20℃ or -80℃; avoid repeated freezing and thawing
Amino Acid SequenceMSFASEFKAFALKGNVVDLAVGVIIGAAFGKIVDSIVNDLVMPVVGAIFGGFDFKDYFVALKEIPPGVPHALDAVKKAGVPVFAYGSFLTIVLNFLILAFIIFLMVKQFNRMKRAEPAPAPAAPPEQVVLLREIRDALRR
Protein NamesLarge-conductance mechanosensitive channel
Gene NamesmscL
Ordered Locus NamesA2cp1_3746
Expression Region1-140
Sequence InfoFull length protein

Research Applications

Recombinant Anaeromyxobacter dehalogenans MscL is utilized in various research applications, including:

  • Structural Biology: Studying the structure and function of mechanosensitive channels .

  • Biophysics: Investigating the mechanisms of channel gating and ion conductance .

  • Biotechnology: Developing novel biosensors and drug delivery systems .

  • Evolutionary Studies: Understanding the evolutionary relationships and adaptations of bacteria in diverse environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; A2cp1_3746; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Target Names
mscL
Target Protein Sequence
MSFASEFKAFALKGNVVDLAVGVIIGAAFGKIVDSIVNDLVMPVVGAIFGGFDFKDYFVA LKEIPPGVPHALDAVKKAGVPVFAYGSFLTIVLNFLILAFIIFLMVKQFNRMKRAEPAPA PAAPPEQVVLLREIRDALRR
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

FAQs for Researchers on Recombinant Anaeromyxobacter dehalogenans Large-Conductance Mechanosensitive Channel (mscL)

Advanced: How do structural discrepancies in MscL oligomerization impact functional studies?

Data Contradiction Analysis:

  • Homopentameric vs. alternative oligomeric states: Cryo-EM and X-ray crystallography typically show pentameric structures , but aberrant oligomerization may occur in non-native expression systems.

    • Resolution: Use analytical ultracentrifugation or native PAGE to confirm oligomeric state post-purification .

    • Example: E. coli-expressed mscL (UniProt A1AGI2) shows consistent pentamerization , whereas misfolded variants may aggregate.

Basic: What are optimal expression and purification strategies for recombinant mscL?

Methodological Answer:

  • Expression system: E. coli BL21(DE3) with induction at OD₆₀₀ ≈ 0.6–0.8 (16°C, 0.1 mM IPTG) .

  • Purification:

    • Use IMAC chromatography for His-tagged variants .

    • Buffer: Tris/PBS with 50% glycerol for stability; avoid freeze-thaw cycles .

  • Yield: ~1–2 mg/L culture for full-length constructs .

Advanced: How do Anaeromyxobacter mscL homologs differ functionally from E. coli MscL?

Comparative Analysis:

FeatureAnaeromyxobacter mscL E. coli MscL
AA SequenceMSFASEFKAF... (1-140aa) MSIIKEFREF... (1-137aa)
ConductanceNot directly measured3.6 nS
Tension ThresholdLikely higher (strain 2CP-1 habitat: soil/sediment) 10–12 mN/m
Structural MotifsUnique cytoplasmic domain Conserved TM3 helix

Methodology: Perform cross-species electrophysiology under identical buffer conditions to directly compare activation thresholds.

Basic: How to troubleshoot low recombinant mscL solubility?

Methodological Answer:

  • Codon optimization: Adjust rare codons in Anaeromyxobacter sequences for E. coli expression .

  • Detergent screening: Test n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) during solubilization .

  • Truncation constructs: Express cytoplasmic or transmembrane domains separately (e.g., 1-140aa vs. 1-120aa) .

Advanced: Can mscL be engineered for synthetic biology applications?

Research Design:

  • Hybrid channels: Fuse mscL with optogenetic domains (e.g., light-sensitive actuators) for controlled gating .

  • Biosensors: Embed mscL in lipid bilayers with fluorophore-tagged subunits to visualize real-time membrane tension changes .

  • Validation: Use single-molecule FRET to confirm conformational changes upon stimulation.

Basic: How to confirm proper folding of recombinant mscL?

Methodological Answer:

  • Circular Dichroism (CD): Check α-helical content (predicted ~70% for TM domains) .

  • Thermal Shift Assay: Monitor melting temperature (Tm) shifts with SYPRO Orange dye .

  • Functional validation: Compare liposome dye release rates with wild-type controls .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.