Recombinant Anaeromyxobacter dehalogenans NADH-quinone oxidoreductase subunit K (nuoK)

What is the structural composition of Anaeromyxobacter dehalogenans NADH-quinone oxidoreductase subunit K?

NADH-quinone oxidoreductase subunit K (nuoK) from Anaeromyxobacter dehalogenans is a membrane-embedded protein consisting of 99 amino acids with the sequence: MPVEYYIWLAAILFGIGLLGVLTKRNALILMMSVELMNAANLTFLAFARRSGDLAGHAIAFFVIAVAAAEAAVGLAVVIAIYRSRGAINVDEVRVLSE . This protein is part of the larger NADH dehydrogenase I complex (also known as Complex I) and functions within the bacterial respiratory chain.

What is the functional role of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase (EC 1.6.99.5) functions as the initial enzyme complex in the bacterial respiratory chain, catalyzing the transfer of electrons from NADH to quinones while simultaneously translocating protons across the membrane . This process is crucial for energy conservation in bacterial metabolism through several mechanisms:

• It oxidizes NADH produced during metabolic processes, regenerating NAD+ for continued cellular metabolism

• It transfers electrons to the quinone pool, feeding the respiratory chain

• It contributes to the generation of a proton gradient across the membrane, which drives ATP synthesis

In anaerobic bacteria like Anaeromyxobacter dehalogenans, this enzyme complex allows for flexible respiratory metabolism using various electron acceptors in the absence of oxygen. The complex is particularly important in anaerobic environments, where A. dehalogenans can utilize metals and halogenated compounds as terminal electron acceptors.

Studies on similar enzyme complexes in other anaerobic bacteria, such as Klebsiella pneumoniae, have demonstrated that NADH oxidase activity can be specifically activated by Na+ or Li+ ions and inhibited by compounds like 2-heptyl-4-hydroxyquinoline-N-oxide (HQNO) . This suggests that ion transport and quinone interaction are essential aspects of the enzyme's function across different bacterial species.

How should researchers design experiments to study the role of nuoK in proton translocation?

Studying the role of nuoK in proton translocation requires a multi-faceted experimental approach that combines molecular genetics, biochemistry, and biophysical techniques. A comprehensive experimental design should include:

Site-Directed Mutagenesis Strategy:

• Identify conserved charged and polar residues within nuoK's transmembrane domains through sequence alignment

• Generate point mutations targeting these residues, particularly:

  • Charged residues (Arg, Glu, Asp) potentially involved in proton wire formation

  • Conserved polar residues (Ser, Thr, Asn) that may participate in hydrogen bonding networks

• Create a systematic mutation library covering different regions of the protein

Functional Characterization Methods:

• Reconstitution Assays:

  • Purify wild-type and mutant proteins and reconstitute into liposomes

  • Incorporate pH-sensitive fluorescent dyes (ACMA or pyranine) inside liposomes

  • Measure proton translocation upon addition of electron donors (NADH)

• Whole-Cell Studies:

  • Complement nuoK deletion strains with wild-type or mutant variants

  • Measure growth rates under respiratory conditions

  • Determine changes in membrane potential using fluorescent probes

Comparative Analysis Framework:

This experimental design allows for correlation between structural elements of nuoK and functional outcomes, revealing its specific role in the proton translocation mechanism of the NADH dehydrogenase complex.

What experimental design is most appropriate for studying the interactions between nuoK and other subunits of the NADH dehydrogenase complex?

To effectively investigate the interactions between nuoK and other subunits of the NADH dehydrogenase complex, researchers should implement a multi-level experimental design that incorporates both in vivo and in vitro approaches:

Genetic Interaction Studies:

• Implement a bacterial two-hybrid system (BACTH) specifically optimized for membrane proteins

• Design fusion constructs with intact transmembrane domains to maintain native topology

• Screen for interactions between nuoK and all other subunits of the complex

• Validate positive interactions through reverse two-hybrid experiments

Biochemical Cross-linking Approach:

• Use membrane-permeable cross-linkers with varying spacer lengths (3-12 Å)

• Apply cross-linking to:

  • Purified complex preparations

  • Membrane fractions

  • Intact cells with complemented variants

• Identify cross-linked partners through mass spectrometry analysis

• Map interaction interfaces by analyzing cross-linked peptides

Biophysical Characterization:

• Develop co-purification strategies for nuoK with interacting partners

• Employ microscale thermophoresis or surface plasmon resonance to measure binding affinities

• Utilize hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

Experimental Design Matrix:

This experimental design follows a progression from identification of interacting partners (bacterial two-hybrid) to detailed characterization of interaction interfaces (cross-linking) and finally to functional significance assessment (suppressor mutations). The combined approach provides comprehensive insights into how nuoK functions within the larger respiratory complex.

How can researchers design experiments to distinguish between direct and indirect effects when studying nuoK mutations?

Distinguishing between direct and indirect effects of nuoK mutations requires carefully controlled experimental designs that isolate specific aspects of protein function. The following experimental framework addresses this challenge:

Comparative Mutational Analysis:

• Create three categories of mutations:

  • Active site mutations (predicted to directly affect catalysis)

  • Structural mutations (predicted to affect protein stability/folding)

  • Interface mutations (predicted to affect subunit interactions)

• Characterize each mutant through multiple functional assays

• Employ the Solomon 4-Group Design to control for testing effects on experimental outcomes

Hierarchical Experimental Approach:

Control Framework to Distinguish Effects:

By implementing this systematic approach and utilizing the experimental design principles outlined in search result , researchers can effectively distinguish between direct mechanistic effects of mutations and secondary consequences resulting from structural perturbations or assembly defects.

What are the optimal conditions for expressing and purifying recombinant Anaeromyxobacter dehalogenans nuoK?

Expression and purification of membrane proteins like nuoK present significant challenges that require optimization at multiple steps. Based on biochemical principles and the specific characteristics of nuoK, the following protocol is recommended:

Expression System Optimization:

• Host Selection:

  • E. coli C41(DE3) or C43(DE3) strains engineered for membrane protein expression

  • Consider Lemo21(DE3) for tunable expression levels

  • Alternative hosts: Lactococcus lactis or cell-free expression systems for toxic proteins

• Expression Conditions:

  • Induction: 0.1-0.3 mM IPTG at reduced temperature (18-20°C)

  • Extended expression time (16-24 hours)

  • Rich media supplemented with glycerol (0.5%) as additional carbon source

  • Potential membrane stabilizers: 1% glucose, 4 mM MgSO₄

Purification Strategy:

• Membrane Preparation:

  • Cell disruption by pressure homogenization in buffer containing:

    • 50 mM Tris-HCl pH 7.5

    • 200 mM NaCl

    • 5% glycerol

    • Protease inhibitor cocktail

  • Membrane isolation by ultracentrifugation (100,000 × g, 1 hour)

• Solubilization Screening:
  Test panel of detergents for optimal extraction:

  Detergent	Working Concentration	Advantages	Considerations
  n-Dodecyl-β-D-maltoside (DDM)	1%	Mild, maintains function	Large micelles
  n-Decyl-β-D-maltoside (DM)	1-2%	Smaller micelles	Potentially harsher
  Lauryl maltose neopentyl glycol (LMNG)	0.5-1%	High stability, low CMC	Expensive
  Styrene maleic acid (SMA)	2.5%	Native lipid environment	pH limitations

• Chromatography Sequence:

  • IMAC (for His-tagged constructs): 20-40 mM imidazole wash, 250 mM imidazole elution

  • Size exclusion chromatography: Superdex 200 in buffer containing 0.05% chosen detergent

  • Optional ion exchange step for further purification

Storage Conditions:

• Store in 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% chosen detergent, 20% glycerol

• Flash freeze in liquid nitrogen and store at -80°C

• For extended stability, consider storing at -20°C in 50% glycerol as described in the product information

This methodological framework provides a starting point that should be optimized empirically for each specific construct, with careful attention to maintaining the functional integrity of nuoK throughout the purification process.

What analytical methods are most effective for characterizing the structure-function relationship of nuoK?

Characterizing the structure-function relationship of nuoK requires an integrated suite of analytical methods that span from molecular to macroscopic levels. The following methodological framework provides comprehensive structural and functional insights:

Structural Characterization Methods:

• Membrane Protein Topology Analysis:

  • Substituted cysteine accessibility method (SCAM)

  • PhoA/LacZ fusion reporters

  • Epitope insertion scanning

• Spectroscopic Techniques:

  • Circular dichroism (CD) for secondary structure determination

  • Fourier-transform infrared spectroscopy (FTIR) for transmembrane helix orientation

  • Electron paramagnetic resonance (EPR) with site-directed spin labeling for conformational dynamics

• High-Resolution Structural Methods:

  • Cryo-electron microscopy within reconstituted complex

  • X-ray crystallography using lipidic cubic phase

  • Solid-state NMR for specific domains or fragments

Functional Characterization Methods:

• Activity Assays:

  • NADH:quinone oxidoreductase activity (monitoring NADH oxidation at 340 nm)

  • Artificial electron acceptor assays (ferricyanide, menadione)

  • Proton translocation measurements in proteoliposomes

• Conformational Change Detection:

  • FRET sensors at key positions to track domain movements

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Luminescence resonance energy transfer (LRET) for precise distance measurements

Integrated Analysis Approach:

Analytical Strategy for Structure-Function Correlation:

• Begin with broad topology mapping to establish protein orientation

• Proceed to targeted functional studies of key regions identified

• Correlate functional data with structural information across multiple states

• Develop an integrated mechanistic model explaining how structural elements contribute to function

This comprehensive analytical framework allows researchers to connect specific structural features of nuoK with functional outcomes, providing insights into its role within the larger NADH dehydrogenase complex.

What methods should be used to assess the role of nuoK in the electron transfer chain of anaerobic bacteria?

Assessing the role of nuoK in the electron transfer chain requires specialized methods that can probe both electron movement and associated proton translocation. The following methodological approach provides a comprehensive framework:

Electron Transfer Analysis:

• Spectroscopic Tracking of Redox Centers:

  • UV-visible spectroscopy to monitor cofactor redox states

  • EPR spectroscopy to detect paramagnetic intermediates

  • Time-resolved spectroscopy to measure electron transfer kinetics

• Electrochemical Methods:

  • Protein film voltammetry on modified electrodes

  • Potentiometric titrations to determine redox potentials

  • Mediated electrocatalysis to probe electron flow pathways

• Inhibitor Studies:

  • Utilize specific inhibitors like HQNO, which has been shown to effectively inhibit NADH oxidase activity in anaerobic bacteria

  • Piericidin A and rotenone as site-specific probes

  • Measure inhibition patterns of wild-type versus mutant complexes

Proton Translocation Coupling Analysis:

• Ion Movement Assays:

  • Similar to studies in Klebsiella pneumoniae, measure Na+ uptake upon NADH oxidation

  • Use ion-selective electrodes to monitor ion movements

  • Apply ionophores (like monensin) and uncouplers (like FCCP) as mechanistic probes

• Membrane Potential Measurements:

  • Voltage-sensitive fluorescent dyes

  • Patch-clamp electrophysiology of reconstituted systems

  • Determination of H+/e- stoichiometry under varying conditions

Reconstitution Studies:

Methodological Workflow:

• Begin with in vitro assays of isolated components to establish baseline activities

• Progress to reconstituted systems of increasing complexity

• Validate findings in membrane vesicles that maintain native context

• Compare results with whole-cell physiological measurements

This systematic approach allows researchers to determine whether nuoK plays a direct role in electron transfer or primarily functions in proton translocation, analogous to studies in Klebsiella pneumoniae that revealed the operation of a primary Na+ pump during anaerobic respiration .

How can researchers effectively analyze contradictory data when studying recombinant nuoK function in different experimental systems?

When faced with contradictory data in nuoK research—a common challenge when studying complex membrane proteins—researchers should implement a systematic analytical framework that identifies sources of variation and establishes experimental robustness:

Sources of Experimental Discrepancies:

• Protein-Related Variables:

  • Expression system differences (E. coli strains, cell-free systems)

  • Purification method variations (detergent types, purification tags)

  • Post-translational modifications or structural heterogeneity

  • Presence/absence of stabilizing lipids or cofactors

• Methodological Variables:

  • Buffer composition (pH, ionic strength, specific ions)

  • Detection method sensitivity and specificity

  • Time-dependent activity changes (protein stability)

  • Temperature and environmental conditions

• Context-Dependent Function:

  • Isolated subunit vs. whole complex behavior

  • Membrane composition effects on activity

  • Coupling efficiency variations in different reconstitution systems

Systematic Resolution Strategy:

Practical Implementation Example:

For contradictory data regarding proton pumping efficiency:

• Verify protein integrity through multiple quality control methods

• Test activity with varied lipid compositions and detergent environments

• Compare activity in different reconstitution systems (proteoliposomes vs. nanodiscs)

• Measure activity across a range of pH values and ion concentrations

• Develop a model incorporating context-dependent regulation of activity

This systematic approach transforms contradictory data from a research obstacle into a valuable opportunity for deeper mechanistic insights into nuoK function, potentially revealing important regulatory features or conformational states of the protein.

What is the potential role of nuoK in the adaptation of Anaeromyxobacter dehalogenans to different electron acceptors in anaerobic environments?

The potential role of nuoK in facilitating adaptation to diverse electron acceptors in anaerobic environments represents an important area of investigation with both fundamental and applied implications. Based on principles of bacterial bioenergetics and the known properties of NADH dehydrogenase complexes, the following research framework can elucidate this role:

Comparative Expression Analysis:

• Quantify nuoK expression levels under growth with different electron acceptors:

  • Metal acceptors (Fe(III), Mn(IV))

  • Halogenated compounds

  • Nitrate/nitrite

  • Oxygen (as control)

• Perform comprehensive proteomics to determine if nuoK undergoes post-translational modifications specific to certain electron acceptors

Electron Acceptor-Specific Adaptation Mechanisms:

Functional Genomics Approach:

• Generate nuoK variants through site-directed mutagenesis of conserved residues

• Assess growth phenotypes with different electron acceptors

• Identify electron acceptor-specific growth defects

• Perform suppressor mutation analysis to identify compensatory pathways

Structural Basis for Adaptability:

• Identify regions of sequence variation in nuoK across Anaeromyxobacter species with different metabolic capabilities

• Model how these variations might affect quinone binding, proton translocation, or subunit interactions

• Test these predictions through chimeric constructs combining domains from different species

• Correlate structural features with functional adaptations to specific electron acceptors

This research approach would reveal whether nuoK functions as a static component of the respiratory chain or if it plays an active role in adapting the bioenergetic machinery to different environmental conditions and electron acceptors. Such insights would contribute to our understanding of how anaerobic bacteria like Anaeromyxobacter dehalogenans achieve metabolic flexibility in diverse environments.

How does the proton translocation mechanism of nuoK compare with that of homologous subunits in other bacterial and mitochondrial respiratory complexes?

Comparative analysis of proton translocation mechanisms between nuoK and its homologs across different respiratory systems provides valuable evolutionary and mechanistic insights. The following research framework enables systematic comparison:

Evolutionary Conservation Analysis:

• Sequence-Based Comparisons:

  • Multiple sequence alignment of nuoK homologs across bacterial phyla and mitochondria

  • Identification of universally conserved residues versus lineage-specific adaptations

  • Determination of conservation patterns in transmembrane versus loop regions

• Structural Comparison:

  • Superposition of available structures (or homology models)

  • Analysis of conserved structural motifs involved in proton pathways

  • Identification of differing elements that might reflect adaptations to specific environments

Functional Mechanism Comparison:

Mechanistic Comparison Strategy:

• Conserved Mechanism Identification:

  • Test whether universally conserved residues serve identical functions across homologs

  • Measure the impact of equivalent mutations in different systems

  • Determine if the fundamental proton pathway architecture is preserved

• Divergent Mechanism Analysis:

  • Characterize unique features of nuoK compared to homologs

  • Identify adaptations specific to anaerobic lifestyle

  • Determine whether differences affect:

    • Proton/electron stoichiometry

    • Regulatory mechanisms

    • Ion specificity (H+ vs. Na+)

    • Coupling efficiency

• Structural Basis for Functional Differences:

  • Map sequence differences to structural models

  • Correlate structural variations with functional differences

  • Create chimeric constructs to test the role of specific structural elements

This comparative approach not only elucidates the specific mechanism of nuoK but also provides insights into the evolution of respiratory complexes and how structural adaptations enable functional specialization across different organisms and environments.

How can understanding the structure and function of nuoK contribute to bioremediation applications involving Anaeromyxobacter dehalogenans?

Understanding the structure-function relationship of nuoK has significant implications for enhancing bioremediation applications that leverage Anaeromyxobacter dehalogenans' unique metabolic capabilities. The following framework outlines how fundamental nuoK research can translate to applied bioremediation strategies:

Mechanistic Insights Supporting Bioremediation:

• Respiratory Efficiency Enhancement:

  • Characterize how nuoK contributes to energy conservation during dehalogenation

  • Identify rate-limiting steps in electron transfer that might constrain bioremediation rates

  • Develop strategies to optimize respiratory efficiency under field conditions

• Metabolic Engineering Targets:

  • Map how electron flow through nuoK connects to dehalogenation pathways

  • Identify potential bottlenecks in energy coupling that limit degradation capacity

  • Design targeted modifications to enhance performance in specific contaminated environments

From Fundamental Research to Field Applications:

Translational Research Strategy:

• Laboratory-Scale Optimization:

  • Develop nuoK variants with enhanced stability or activity

  • Test performance in simulated contaminated environments

  • Measure degradation rates and correlation with respiratory activity

• Microcosm Studies:

  • Compare wild-type and optimized strains in actual contaminated soil/water samples

  • Assess persistence and activity under competitive conditions

  • Determine if laboratory-observed improvements translate to environmental samples

• Field Application Development:

  • Design delivery systems for optimized strains or communities

  • Develop monitoring tools based on nuoK activity as a biomarker

  • Create integrated bioremediation platforms combining optimized microbes with appropriate nutrients and electron donors

This research direction connects fundamental understanding of nuoK function with practical applications in environmental cleanup, potentially enhancing the effectiveness of Anaeromyxobacter dehalogenans in remediating halogenated pollutants in anaerobic environments.

What research methodologies can elucidate the potential role of nuoK in microbial electron transfer to metals and minerals?

Investigating the role of nuoK in extracellular electron transfer to metals and minerals requires specialized methodologies that bridge molecular biology, electrochemistry, and materials science. The following research framework provides comprehensive insights into this important aspect of Anaeromyxobacter metabolism:

Integrated Methodological Approach:

• Genetic and Molecular Methods:

  • Generate nuoK deletion and point mutation variants

  • Create fluorescent/luminescent reporter fusions to track expression under metal-reducing conditions

  • Perform transcriptomic analysis comparing growth with soluble vs. insoluble electron acceptors

• Bioelectrochemical Methods:

  • Develop microbial fuel cell systems with defined anode materials

  • Measure electron transfer rates of wild-type vs. nuoK variants

  • Perform cyclic voltammetry to characterize redox properties

  • Use electrochemical impedance spectroscopy to detect membrane-associated electron transfer processes

• Microscopic and Spectroscopic Techniques:

  • Visualize cell-mineral interfaces using electron microscopy

  • Apply scanning electrochemical microscopy to map localized electron transfer

  • Utilize X-ray absorption spectroscopy to track metal reduction states

Experimental Design Matrix:

Mineral Interaction Specificity:

• Test reduction rates of different metal oxides (Fe(III), Mn(IV), U(VI))

• Characterize mineral phase transformations during reduction

• Determine if nuoK variants show acceptor-specific defects

• Correlate reduction rates with energy conservation efficiency

Advanced Biophysical Approach:

• Reconstitute purified nuoK (wild-type and variants) with minimal electron transfer components

• Measure direct electron transfer to mineral surfaces

• Determine kinetic parameters and electron transfer mechanisms

• Compare with whole-cell systems to identify additional required components

This methodological framework allows researchers to determine whether nuoK plays a direct role in metal reduction or if it primarily functions in energy conservation during this process, contributing to our understanding of microbial interactions with geological materials in anaerobic environments.