Recombinant Anaeromyxobacter dehalogenans Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your requested tag.
Synonyms
secD; Adeh_2540; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-613
Protein Length
full length protein
Species
Anaeromyxobacter dehalogenans (strain 2CP-C)
Target Names
secD
Target Protein Sequence
MERSWYWRVALVVAVAILSIYQLVPSWFYFKLPPDQRNTEAYDTSVPGWAPDAKHHLNLG LDLQGGILLSMGVDVDRAVKTKVARRADEIGEFLKGKNVAFTGTKVVGGGAQVEVSAANP GEVKDAVLGSTGYSEEMYSPGGAPDGAVRFAFKDSVLRDFREKAVKQAEKVIRNRVDKWG VTEPDIKTKANNQIQVQLPGFKDPEKAKELLGRTAQLEFKIADDENPVLDQVRTQLPQCQ GDRQGLSLPLPESGCWTVEPVELPSGGSRAATMVAANTRTELEKVITEKLNPLLDPQKNV VGIGEGQVGQGPIKTTYYRTYLLRAKTELTGDYIADAAVAIDQSDTLQRGRPVVSFKMSP EGARLMDKLTSENMRRRMATVLDDKVETAPYIQGRISSNGQITLGSGRNQQDMFDEANGI ALVLKAGALPAPVTITEERTVGATLGPELVRKGTLAALVGLALVVVFMVVYYRGTGLVAD VALALNGLLVLAVMSMIGTTLTLPGIAGFVLTLGMAVDANVLINERIREEMRAGRNVRQS VQLGYDRVFWTIVDSHVTTLVAGVVLFQYGSGPIRGFAVTLIIGLVASMFTSIVVTRVIM EYFTRHDTARLSV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaeromyxobacter dehalogenans and why is it significant for protein translocation studies?

Anaeromyxobacter dehalogenans is a δ-proteobacterium found in diverse soils and sediments with remarkable metabolic versatility . It has gained research attention due to its dechlorination and metal-reducing capabilities, making it valuable for bioremediation applications . The organism represents an interesting model for studying protein translocation mechanisms in environmentally relevant bacteria that can survive in diverse conditions. A. dehalogenans strain 2CP-C stands out as one of the few isolates capable of both metal reduction and chlororespiration, with demonstrated ability to couple the oxidation of acetate to the reduction of ortho-substituted halophenols, oxygen, nitrate, nitrite, fumarate, and various iron compounds .

What is the Sec protein translocation pathway and how does SecD function within it?

The Sec machinery (or translocase) provides a major pathway for protein translocation from the cytosol across the cytoplasmic membrane in bacteria . In this pathway, the SecA ATPase interacts dynamically with integral membrane components, including SecY, SecE, and SecG (collectively known as SecYEG), to drive the transmembrane movement of newly synthesized preproteins . SecD functions as an accessory subunit that enhances the efficiency of protein translocation. The Sec pathway is not only crucial for protein secretion but also serves as a mechanism for the integration of certain membrane proteins . The system interacts with various cellular components to fulfill its roles, with SecD specifically thought to be involved in the later stages of translocation, potentially helping to release proteins into the periplasm.

How does the SecD protein in A. dehalogenans compare structurally to SecD proteins in other bacterial species?

While specific structural comparisons of SecD from A. dehalogenans with other bacterial SecD proteins are not detailed in the provided research, general principles suggest some conservation. The SecD protein typically contains multiple transmembrane domains and a large periplasmic domain. In model organisms like E. coli, SecD works in conjunction with SecF and YajC to form a subcomplex that associates with the core SecYEG translocon. Comparative genomic analyses would be necessary to determine the degree of sequence homology and structural conservation between A. dehalogenans SecD and those of well-characterized model organisms. Such analysis could reveal adaptations specific to the environmental versatility of A. dehalogenans.

What are the optimal expression systems for producing recombinant A. dehalogenans SecD protein?

For recombinant expression of A. dehalogenans SecD, heterologous expression systems such as E. coli BL21(DE3) with appropriate expression vectors (pET series) have proven effective for similar membrane proteins. The methodology should include careful optimization of induction conditions (IPTG concentration, temperature, duration) to prevent formation of inclusion bodies, given SecD's membrane-associated nature. Membrane protein expression may benefit from specialized E. coli strains like C41(DE3) or C43(DE3) designed for toxic membrane proteins. For purification, a combination of detergent solubilization (typically with n-dodecyl-β-D-maltoside or similar mild detergents) followed by affinity chromatography using histidine or other affinity tags is recommended. Expression verification can be performed via Western blotting using antibodies against the affinity tag or against conserved SecD epitopes.

What techniques are most effective for studying the interaction between SecD and other components of the Sec translocation machinery in A. dehalogenans?

For investigating SecD interactions with other Sec components in A. dehalogenans, multiple complementary approaches are recommended:

  • Co-immunoprecipitation and pull-down assays: Using antibodies against SecD or associated tags to isolate protein complexes, followed by mass spectrometry identification of binding partners.

  • Chemical cross-linking coupled with mass spectrometry: This approach can capture transient interactions within the Sec machinery.

  • Bacterial two-hybrid assays: Useful for screening potential protein-protein interactions in vivo.

  • FRET/BRET analyses: For studying dynamics of interactions in real-time if fluorescent protein fusions are viable.

  • Cryo-electron microscopy: For structural characterization of the entire translocon complex.

Experiments should be designed with appropriate controls to distinguish specific from non-specific interactions, particularly important when working with membrane proteins that can form artifactual associations.

How can researchers effectively measure the translocation activity of SecD in A. dehalogenans?

To assess SecD translocation activity in A. dehalogenans, researchers should employ translocation assays using reporter proteins with known secretion patterns. Methodological approaches include:

  • In vitro translocation assays: Using inverted membrane vesicles prepared from A. dehalogenans with purified components of the Sec machinery and radiolabeled or fluorescently tagged preproteins. Successful translocation can be verified by protease protection assays.

  • In vivo secretion assays: Measuring the accumulation of secreted reporter proteins in the periplasm versus cytoplasm using cellular fractionation techniques.

  • Complementation studies: In SecD-depleted or conditional mutant strains, monitoring the restoration of protein secretion and cellular viability.

  • ATPase activity measurements: Assessing the stimulation of SecA ATPase activity in the presence vs. absence of functional SecD.

How does the environment-specific adaptation of A. dehalogenans influence the function of its Sec translocation system?

A. dehalogenans exhibits remarkable metabolic versatility, capable of growth under both aerobic and anaerobic conditions and utilizing diverse electron acceptors including oxygen, nitrate, fumarate, Fe(III) compounds, and halogenated organics . This metabolic flexibility raises intriguing questions about how the Sec translocation system, including SecD, might be regulated or structurally adapted to function optimally across these diverse conditions. Research indicates that A. dehalogenans can coordinate multiple respiratory pathways, with some constitutively expressed (like Fe(III) reduction) and others inducible (like chlororespiration) . This regulatory pattern suggests that protein translocation systems may similarly demonstrate environment-specific adaptations.

Investigation approaches could include:

  • Comparative proteomics of the Sec machinery components under different growth conditions

  • Analysis of SecD expression patterns correlated with environmental shifts

  • Structural studies to identify potential adaptations in the A. dehalogenans SecD that might facilitate function under varying redox conditions

What is the potential role of SecD in the transport of proteins involved in the unique metal-reduction and dechlorination pathways of A. dehalogenans?

A. dehalogenans possesses specialized proteins for its distinctive metabolic capabilities, including those involved in Fe(III) reduction and dechlorination of ortho-substituted halophenols . The SecD subunit may play a critical role in the translocation of these environmentally important proteins. Studies have shown that A. dehalogenans strain 2CP-C can grow by coupling Fe(III) reduction to acetate oxidation with doubling times comparable to those for chlororespiration (9.2 hours for Fe(III) reduction versus 10.2 hours for 2-chlorophenol reduction) .

Research indicates differential regulation of these pathways, with Fe(III) reduction appearing constitutive while chlororespiration is inducible . This suggests a potential need for rapid, condition-specific translocation of different protein subsets, highlighting the importance of an efficient SecD function.

The interaction between these metabolic pathways is complex - for example, soluble ferric pyrophosphate has been shown to inhibit dechlorination, while insoluble Fe(III) oxyhydroxide does not significantly affect this process . Understanding how SecD contributes to the proper localization of the proteins involved in these sometimes competing processes would provide valuable insights into the organism's environmental adaptability.

What structural features of A. dehalogenans SecD might contribute to its function under the diverse environmental conditions where this organism thrives?

While specific structural information for A. dehalogenans SecD is not detailed in the provided research, this represents an important area for investigation. The unusual environmental versatility of A. dehalogenans suggests potential structural adaptations in its protein translocation machinery. Based on knowledge of SecD in other organisms combined with A. dehalogenans' ecology, researchers might investigate:

  • Potential adaptations in the periplasmic domain of SecD that could facilitate protein translocation under varying redox conditions

  • Modifications in transmembrane domains that might respond to changes in membrane fluidity as the organism transitions between aerobic and anaerobic environments

  • Structural features that could enhance stability under the diverse pH and ionic conditions encountered in soil and sediment environments

Advanced structural biology techniques including X-ray crystallography, cryo-electron microscopy, and molecular dynamics simulations would be valuable approaches for addressing these questions.

How might understanding SecD function in A. dehalogenans inform bioremediation strategies?

Understanding the SecD function in A. dehalogenans has significant implications for bioremediation applications. This organism's dual capability for both metal reduction and reductive dechlorination makes it promising for sites co-contaminated with metals and chlorinated compounds . The Sec translocation system, including SecD, is likely critical for the proper localization of enzymes involved in both processes.

Research into SecD could reveal:

  • How the translocation of key bioremediation-related proteins is regulated under different environmental conditions

  • Potential rate-limiting steps in the deployment of metal reductases and dehalogenases to their proper cellular locations

  • Opportunities to enhance bioremediation efficiency through optimized protein translocation

Understanding these mechanisms could lead to bioengineering approaches that optimize A. dehalogenans for specific contamination scenarios by ensuring efficient translocation of the most relevant detoxification enzymes.

What approaches can be used to study the in vivo dynamics of SecD function in A. dehalogenans during environmental transitions?

To study SecD dynamics during environmental transitions in A. dehalogenans, researchers should employ multi-faceted approaches:

  • Time-resolved transcriptomics and proteomics: Tracking changes in expression of secD and related genes/proteins as A. dehalogenans transitions between different electron acceptors (e.g., from aerobic to Fe(III)-reducing or chlororespiring conditions)

  • Fluorescent protein fusions: If genetically tractable, creating SecD-fluorescent protein fusions to visualize localization and dynamics during environmental shifts

  • Conditional knockdowns: Developing systems for controlled reduction of SecD expression to assess impacts on adaptation to new environments

  • Protein-protein interaction studies: Using crosslinking approaches at different time points during environmental transitions to capture changing interaction partners of SecD

  • Ribosome profiling: To assess translational regulation of secD and client proteins during adaptation to new conditions

Researchers examining paddy soil environments have demonstrated that Anaeromyxobacter community structure changes over flooding time, with corresponding changes in Fe(III) reduction activity , suggesting that protein expression and translocation requirements likely shift significantly during environmental transitions.

How can comparative genomic approaches enhance our understanding of SecD evolution in Anaeromyxobacter species?

Comparative genomic approaches offer powerful tools for understanding SecD evolution in Anaeromyxobacter species and its relationship to environmental adaptation. A. dehalogenans represents one of the few myxobacteria capable of anaerobic respiration , suggesting unique evolutionary adaptations in its protein translocation machinery.

Research approaches should include:

  • Phylogenetic analysis: Constructing phylogenetic trees of SecD sequences across Anaeromyxobacter strains and related bacteria to identify patterns of conservation and divergence

  • Positive selection analysis: Identifying specific amino acid residues under positive selection that might confer adaptive advantages in different environments

  • Structural prediction and comparison: Using homology modeling to predict structural differences in SecD across species that might relate to functional specialization

  • Horizontal gene transfer assessment: Evaluating whether SecD components in Anaeromyxobacter show evidence of horizontal acquisition from other anaerobic bacteria

  • Correlation with ecological niches: Relating SecD sequence variation to the specific environmental niches occupied by different Anaeromyxobacter strains

Studies of Anaeromyxobacter in paddy soils have identified at least 10 major Anaeromyxobacter types that can be divided into distinct phylogenetic groups , suggesting that comparative analysis across these variants could reveal important adaptations in protein translocation machinery related to specific environmental conditions.

What are the key interaction partners of SecD in the context of A. dehalogenans protein translocation?

In A. dehalogenans, SecD likely participates in a network of protein interactions similar to those observed in other bacterial systems, though with potential adaptations specific to this organism's unique physiology. The primary interaction partners would include:

  • SecF and YajC: Typically forming a subcomplex (SecDF-YajC) that associates with the core translocon

  • SecYEG complex: The central channel-forming component of the translocase

  • SecA: The ATPase providing energy for translocation

  • Preprotein substrates: Including those involved in A. dehalogenans' distinctive metabolic pathways

The specific nature of these interactions in A. dehalogenans would be valuable to characterize, particularly for proteins involved in the organism's metal reduction and dehalogenation capabilities. The metal-reducing and dechlorinating enzymes likely represent important substrates for the Sec machinery in this organism .

What experimental challenges must be overcome when studying membrane proteins like SecD in environmentally relevant bacteria?

Studying membrane proteins like SecD in environmentally relevant bacteria such as A. dehalogenans presents several significant challenges:

  • Genetic tractability: Environmental bacteria often lack well-established genetic manipulation systems, complicating the creation of tagged variants or knockout mutants

  • Expression and purification difficulties: Membrane proteins are notoriously challenging to express and purify in functional form

  • Lipid environment requirements: Maintaining proper function often requires specific lipid compositions that mimic the native membrane

  • Structural determination complexities: Membrane proteins present special challenges for structural biology techniques

  • Growth conditions: A. dehalogenans requires specialized anaerobic cultivation techniques, particularly when studying proteins involved in anaerobic respiration pathways

Overcoming these challenges requires interdisciplinary approaches combining microbiology, biochemistry, structural biology, and systems biology. Development of genetic tools specifically for A. dehalogenans would significantly advance this field.

Experimental ApproachAdvantagesLimitationsApplication to SecD
Heterologous expressionSimpler genetic manipulationMay lack proper folding/modificationInitial protein production
Native expressionAuthentic processing and foldingLower yields, complex purificationFunctional studies
Liposome reconstitutionControlled lipid environmentArtificial systemTransport assays
Cryo-EMVisualizes membrane proteins in near-native stateResolution challengesStructural studies
Crosslinking-MSCaptures transient interactionsPotential artifactsInteraction mapping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.