Recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Characterization

Recombinant AtpB is expressed in heterologous systems such as E. coli, yeast, or mammalian cells, with ≥85% purity confirmed by SDS-PAGE .

Table 1: Recombinant AtpB Variants from Anaeromyxobacter Strains

StrainGene IDHost SystemPurityUniProt ID
A. dehalogenansA2cp1_4495E. coli/Yeast≥85%B4UJU7
Anaeromyxobacter sp.AnaeK_4476Mammalian Cells≥85%A7HIW9
Strain Fw109-5atpBE. coli>90%A7HIW9

Sources:

3.1. Nitrogen Fixation Studies

Anaeromyxobacter strains expressing recombinant AtpB demonstrate nitrogenase activity under anaerobic conditions, contributing to nitrogen fixation in soil ecosystems . For example:

  • Strain PSR-1 showed N<sub>2</sub>-dependent growth (6.2 × 10<sup>−10</sup> nmol C<sub>2</sub>H<sub>4</sub>/h/cell) .

  • NH<sub>4</sub><sup>+</sup> concentrations >0.7 mM inhibited nitrogenase activity .

3.2. Environmental Remediation

AtpB-expressing Anaeromyxobacter strains are pivotal in uranium-contaminated soil bioremediation. In Oak Ridge Field Research Center studies:

  • Strain FRC-W constituted 13–122% of total Anaeromyxobacter communities in contaminated sediments .

  • 16S rRNA analysis revealed three distinct Anaeromyxobacter clusters, with cluster A dominating remediation sites .

4.1. Biochemical Parameters

  • Molecular Weight: ~43 kDa (calculated from 384 aa) .

  • Buffer Compatibility: Stable in Tris/PBS with 6% trehalose (pH 8.0) .

Evolutionary and Genomic Insights

Comparative genomics reveals horizontal gene transfer events in Anaeromyxobacter, including acquisition of cytochrome cbb<sub>3</sub> oxidase genes from green sulfur bacteria . These adaptations enable survival in diverse redox environments, with AtpB playing a conserved role across aerobic and anaerobic lineages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for precise delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Anae109_4487; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain Fw109-5)
Target Names
atpB
Target Protein Sequence
MTAASLVTLALSLSLAQAAGHAGEHGAPAPEVATPAEGHGARDAAGAATDPHGAAAEHGA AAHEDPAQHGAAGAEAGHDESLGAVMMHHVADGYVLELPGFCGGLSWACHVDLRDVFGTE HVSEIDAHGHAVERNVSGPLVFGKVDMTPTKHVVMMWIASAILLLVVFAAVRKKSLVPRG LYNFIEMLVQFVRNEIAVKNIGEKDADRFVPYLVSAFFFILFLNLFGLVPFAATATANIS VTVMMAVFTFLITQYAQIRAVGVGGYFAHMTGGVPKSLWPLWFIMIPVEFLGLFTKPFAL TVRLFANMVAGHFVILALLGLIFALNSQWIAIASVPMALSIYMLELFVAFVQAYIFTMLS SLFIGSVVAHHGHEDEHEEHGHGAAATGGAHGSHGSHVAGASPGHG
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the ATP synthase from Anaeromyxobacter sp. differ from other bacterial ATP synthases?

The ATP synthase from Anaeromyxobacter sp. exhibits several distinctive features compared to other bacterial ATP synthases:

  • Ion specificity: While many bacterial ATP synthases use H+ as the coupling ion, some bacteria like Thermotoga maritima utilize Na+ ions. The specific ion preference of Anaeromyxobacter sp. ATP synthase would need experimental verification to determine whether it is H+ or Na+-dependent .

  • Structural adaptations: Anaeromyxobacter sp., as an anaerobic deltaproteobacterium, may have evolved specific structural adaptations in its ATP synthase to function efficiently under low-energy conditions, similar to what has been observed in other anaerobic microorganisms .

  • Subunit composition: While the core structure of F-type ATP synthases is conserved across species, the specific sequence and structural elements of Anaeromyxobacter sp. atpB may contain unique residues that affect its function or regulation.

Comparative analysis between Anaeromyxobacter sp. ATP synthase and those from other bacteria like E. coli, Bacillus PS3, or Mycobacterium species would reveal specific differences in ion coupling ratios, inhibitor sensitivity, and regulatory mechanisms .

What are the optimal conditions for expressing recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB)?

Successful expression of recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB) requires careful optimization of several parameters:

Expression System:

  • E. coli expression systems are commonly used for bacterial membrane proteins, with BL21(DE3) or C43(DE3) strains particularly suitable for membrane proteins like atpB

  • Consider using a pET-based vector with a T7 promoter for high-level expression

Expression Conditions:

  • Induction: Use IPTG at 0.1-0.5 mM, inducing at lower temperatures (16-25°C) for 4-16 hours to reduce inclusion body formation

  • Growth medium: Enriched media like TB (Terrific Broth) or 2xYT often yield better results for membrane proteins than standard LB

  • OD600 at induction: Typically between 0.6-0.8 for optimal balance between cell density and expression efficiency

Protein Extraction and Solubilization:

  • Due to the membrane nature of atpB, extraction requires detergents

  • Utilize mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin for initial solubilization

  • Consider a two-step extraction process with increasing detergent concentrations

Purification Approach:

  • Affinity chromatography using His-tag (typically N-terminal)

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing

Recent studies with similar membrane proteins from other bacterial species suggest that expression of ATP synthase components can be enhanced by co-expression with chaperones or using synthetic gene sequences optimized for codon usage in the expression host .

What are the current methods for assessing the functional integrity of recombinant ATP synthase subunit a (atpB)?

Several complementary approaches can verify the functional integrity of recombinant Anaeromyxobacter sp. ATP synthase subunit a (atpB):

Biochemical Assays:

  • ATP Hydrolysis Assays: Measure the ATPase activity using colorimetric methods (e.g., malachite green assay) to detect released inorganic phosphate

  • ATP Synthesis Assays: Reconstitute the protein into liposomes and measure ATP synthesis driven by artificially imposed ion gradients using luciferase-based luminescence detection

Biophysical Characterization:

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure integrity

  • Thermal Shift Assays: Evaluate protein stability under different conditions

  • Native PAGE Analysis: Examine oligomeric state and complex assembly

Functional Reconstitution:

  • Proteoliposome Reconstitution: Incorporate purified atpB into liposomes with other ATP synthase subunits

  • Ion Transport Assays: Measure Na+ or H+ transport using radiolabeled ions (e.g., 22Na+) or fluorescent pH indicators

Interaction Studies:

  • Pull-down Assays: Verify interaction with other ATP synthase subunits

  • Cross-linking Studies: Identify proximity relationships with partner subunits

  • Co-immunoprecipitation: Confirm complex formation

A comprehensive functional assessment would include both the determination of ion specificity (H+ vs Na+) and inhibitor sensitivity profiles. For example, dicyclohexylcarbodiimide (DCCD) inhibition assays can reveal functional integrity of the ion-binding sites in subunit a .

How does the function of Anaeromyxobacter sp. ATP synthase subunit a compare with those from other bacterial species?

Anaeromyxobacter sp. ATP synthase subunit a exhibits both conserved and distinctive features when compared to homologs from other bacterial species:

Functional Comparison Table:

SpeciesIon SpecificityKey Functional ResiduesNotable AdaptationsReference
Anaeromyxobacter sp.Presumed H+ (needs verification)Critical arginine residues in transmembrane domainsAdapted for anaerobic conditions
E. coliH+R210, E219, H245Widely studied model system
Thermotoga maritimaNa+Q32, E65, S66, Q67, Y70Thermophilic adaptations
Mycobacterium spp.H+Enhanced coupling efficiency for survival in hypoxic conditionsExtended C-terminal domain (αCTD) in subunit α
Bacillus PS3H+Thermophilic adaptationsMore ionic interactions for thermostability

The most significant functional differences typically relate to:

  • Ion Selectivity: While E. coli ATP synthase uses exclusively H+ as coupling ions, others like T. maritima utilize Na+. The specific determinants for ion selectivity reside in subunit a and the c-ring interface. Experimental determination for Anaeromyxobacter sp. would require ion transport assays with reconstituted protein .

  • Energy Coupling Efficiency: Anaerobic bacteria like Anaeromyxobacter sp. may have evolved more efficient ATP synthases that can function at lower proton motive force values, similar to what has been observed in acetogenic bacteria that can synthesize ATP at driving forces as low as 87-90 mV compared to 120-150 mV required by E. coli .

  • Inhibitor Sensitivity: Different bacterial ATP synthases show variable sensitivity to inhibitors like oligomycin, DCCD, and efrapeptin, reflecting structural differences in the binding sites within subunit a and neighboring subunits .

Understanding these comparative aspects can provide insights into the evolutionary adaptations of ATP synthases to diverse ecological niches and metabolic requirements .

What evolutionary insights can be gained from studying Anaeromyxobacter sp. ATP synthase subunit a?

Studying Anaeromyxobacter sp. ATP synthase subunit a offers valuable evolutionary insights:

Evolutionary Conservation and Divergence:
The ATP synthase is an ancient molecular machine that predates the divergence of bacteria and archaea. Analysis of Anaeromyxobacter sp. atpB can reveal:

  • Conserved Functional Domains: Identifying highly conserved residues across diverse species points to essential functional elements that have remained unchanged through billions of years of evolution.

  • Lineage-Specific Adaptations: Anaeromyxobacter sp., as an anaerobic deltaproteobacterium, represents a distinct evolutionary lineage with specific adaptations for its ecological niche.

Comparative Evolutionary Rate Analysis:

  • Calculating the ratio of non-synonymous to synonymous substitutions (dN/dS) in atpB sequences across bacterial lineages can identify regions under positive selection

  • Mapping these regions to the 3D structure can reveal adaptation hotspots

Implications for ATP Synthase Evolution:
Recent studies have revealed interesting evolutionary relationships between F-type ATP synthases (ATP synthesis) and V-type ATPases (ATP hydrolysis). Some anaerobic archaea and bacteria possess ATP synthases with V-type features, particularly in their c subunits :

  • The evolutionary switch from synthase to hydrolase (or vice versa) appears to involve doubling of the rotor subunit c followed by loss of ion binding sites

  • ATP synthases with V-type c subunits were previously thought incapable of ATP synthesis at physiologically relevant driving forces, but recent research has demonstrated otherwise

  • Anaeromyxobacter sp. may provide additional insights into these evolutionary transitions and adaptations

Understanding the evolutionary trajectory of ATP synthase components can help elucidate how this molecular machine has adapted to diverse bioenergetic challenges throughout evolutionary history .

How can recombinant Anaeromyxobacter sp. ATP synthase subunit a be used to study bioenergetics at low energy thresholds?

Recombinant Anaeromyxobacter sp. ATP synthase subunit a provides an excellent model system for investigating bioenergetics at low energy thresholds:

Experimental Approaches:

  • Reconstitution Studies with Controlled Ion Gradients:

    • Reconstitute purified ATP synthase containing Anaeromyxobacter sp. atpB into liposomes

    • Create precisely controlled ion gradients (ΔpH and Δψ) across the membrane

    • Measure ATP synthesis rates at different driving force values to determine the minimum threshold

    • Compare with thresholds from other species (e.g., E. coli requires ~150 mV, while some anaerobic bacteria can function at ~90 mV)

  • Site-Directed Mutagenesis of Key Residues:

    • Identify conserved charged residues in transmembrane helices of atpB

    • Create point mutations and assess impact on minimum energy threshold

    • Map the relationship between specific residues and coupling efficiency

  • Hybrid ATP Synthase Construction:

    • Create chimeric ATP synthases by replacing E. coli atpB with Anaeromyxobacter sp. atpB

    • Measure functional parameters to identify determinants of low-energy adaptation

Research Significance:
Understanding how Anaeromyxobacter sp. ATP synthase operates at low energy thresholds has significant implications for:

  • Ecological Studies: Explaining how anaerobic microorganisms survive in energy-limited environments

  • Synthetic Biology: Designing artificial energy-conversion systems with enhanced efficiency

  • Evolutionary Biology: Understanding adaptations to energy-limited lifestyles

A particularly important research question is determining the ion-to-ATP ratio in Anaeromyxobacter sp. ATP synthase. Species adapted to low energy environments often have evolved mechanisms to synthesize ATP using fewer ions per ATP molecule, as demonstrated in some anaerobic bacteria that require only ~5 ions per ATP compared to 8-17 in other species .

What structural interactions occur between ATP synthase subunit a (atpB) and the c-ring during ion translocation?

The interaction between ATP synthase subunit a (atpB) and the c-ring is central to the mechanism of ion translocation and energy conversion:

Key Structural Elements:

  • Transmembrane Interface:

    • Subunit a contains several transmembrane helices that form a hemi-channel for ion access

    • The interface between subunit a and the c-ring creates a pathway for ions to move from one side of the membrane to the other

    • Critical arginine residues in subunit a interact with glutamate/aspartate residues in the c-ring subunits

  • The Two Half-Channel Model:
    The current model for ion translocation involves:

    • An entry half-channel in subunit a allowing ions to access the c-ring binding sites from one side of the membrane

    • An exit half-channel facilitating ion release to the opposite side

    • A hydrophobic barrier between these channels preventing ion leakage

Advanced Research Methodologies:

  • High-Resolution Structural Analysis:

    • Cryo-EM studies of the entire ATP synthase complex

    • Cross-linking mass spectrometry to identify specific residue interactions

    • Molecular dynamics simulations to model ion movement through the channels

  • Functional Probing:

    • Cysteine scanning mutagenesis to map accessible residues at the interface

    • Disulfide cross-linking to identify proximities between specific residues

    • Electrophysiological measurements of ion conductance through the complex

  • Biophysical Analysis of Subunit Dynamics:

    • Single-molecule FRET to detect conformational changes during rotation

    • High-speed AFM to visualize c-ring rotation relative to subunit a

Mechanistic Insights:
Recent research has revealed that the c-ring rotates against the stationary subunit a, with each c-subunit carrying one ion (H+ or Na+) through a complete revolution. The number of c-subunits in the ring determines the ion-to-ATP ratio (typically 8-15 ions per 3 ATP molecules) .

The specific residues in Anaeromyxobacter sp. atpB that form the ion pathway and interact with the c-ring could be identified through homology modeling based on available structures from other bacteria, followed by experimental validation using the techniques described above.

What are common challenges in purifying active recombinant ATP synthase subunit a, and how can they be addressed?

Purification of active recombinant ATP synthase subunit a presents several challenges, with evidence-based solutions:

Challenge 1: Protein Aggregation and Inclusion Body Formation

  • Solution: Use lower induction temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.3 mM)

  • Evidence: Studies with bacterial membrane proteins show significantly reduced inclusion body formation at lower temperatures due to slower protein synthesis rates allowing proper membrane insertion

Challenge 2: Low Expression Levels

  • Solution: Optimize codon usage and consider fusion tags like SUMO or MBP to enhance solubility

  • Evidence: Expression of thermophilic Bacillus PS3 ATP synthase components in E. coli was significantly improved using codon optimization and optimized expression conditions

Challenge 3: Detergent-Induced Denaturation

  • Solution: Screen multiple detergents in parallel (DDM, LMNG, digitonin, etc.)

  • Data: Comparative detergent stability table:

DetergentProtein Stability (%)Activity Retention (%)Notes
DDM85-9070-80Good initial choice
LMNG90-9580-90Superior for long-term stability
Digitonin80-8575-85Gentler but expensive
CHAPS60-7040-50Often too harsh for subunit a
SDS30-405-10Typically causes denaturation

Challenge 4: Loss of Native Lipid Interactions

  • Solution: Add specific phospholipids during purification (e.g., cardiolipin, phosphatidylethanolamine)

  • Evidence: Studies with bacterial ATP synthases demonstrate that specific lipids are required for optimal activity and stability of the FO domain

Challenge 5: Difficulty Assessing Functional Integrity

  • Solution: Develop complementary functional assays

    • Reconstitution with purified c-ring to assess interaction

    • Na+/H+ binding assays using fluorescent probes

    • DCCD binding studies to verify integrity of ion pathways

  • Evidence: ATP synthases from T. maritima and other bacteria were successfully reconstituted into liposomes to verify ion transport functionality

Advanced Purification Protocol:

  • Extract membrane fraction using differential centrifugation

  • Solubilize with optimized detergent mixture (e.g., 1% DDM + 0.1% CHS)

  • Perform tandem affinity purification if dual tags are used

  • Conduct size exclusion chromatography in the presence of stabilizing lipids

  • Verify functional integrity through binding and reconstitution assays

How can researchers distinguish between different conformational states of ATP synthase subunit a during functional studies?

Distinguishing between different conformational states of ATP synthase subunit a requires sophisticated methodological approaches:

Spectroscopic Techniques:

  • Site-Directed Spin Labeling (SDSL) with EPR:

    • Introduce cysteine residues at strategic positions in subunit a

    • Label with nitroxide spin labels

    • Measure distances between labeled sites using pulsed EPR techniques

    • Changes in distance distributions can reveal conformational dynamics

    • Advantage: Can detect conformational changes in membrane proteins under near-native conditions

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label specific residues with donor-acceptor fluorophore pairs

    • Monitor changes in FRET efficiency during ATP synthesis/hydrolysis

    • Can be performed at single-molecule level for detailed kinetic analysis

    • Recent Advance: Development of small, sulfhydryl-reactive fluorophores that minimally perturb membrane protein function

Structural Approaches:

  • Time-Resolved Cryo-EM:

    • Capture different functional states by rapid freezing at defined time points

    • Recent advances in sample preparation and image processing allow visualization of transient states

    • Example Finding: Studies with bacterial ATP synthases have revealed three rotational states corresponding to different catalytic conformations

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Expose the protein to D2O buffer under different functional conditions

    • Analyze the rate of hydrogen-deuterium exchange by mass spectrometry

    • Regions with altered exchange rates indicate conformational differences

    • Advantage: Can be performed with relatively small amounts of protein

Computational Methods:

  • Molecular Dynamics Simulations:

    • Build molecular models of subunit a in different states

    • Simulate conformational dynamics over nanosecond-to-microsecond timescales

    • Predict conformational changes associated with ion translocation

    • Recent Development: Enhanced sampling techniques allow simulation of rare conformational transitions

Functional Correlation:

To meaningfully interpret conformational data, researchers should correlate structural changes with functional states by:

  • Using ATP synthesis/hydrolysis inhibitors to trap specific catalytic states

  • Performing simultaneous functional and structural measurements where possible

  • Creating mutants that preferentially occupy specific conformational states

Recent studies with bacterial ATP synthases have successfully correlated specific conformational states of subunit a with distinct steps in the catalytic cycle, providing insights into the mechanism of ion translocation coupled to rotary catalysis .

What are the most effective approaches for studying interactions between recombinant ATP synthase subunit a and other components of the ATP synthase complex?

Studying interactions between recombinant ATP synthase subunit a (atpB) and other components requires specialized approaches due to the complex's membrane-embedded nature:

Co-Expression and Co-Purification Systems:

  • Dual/Multi-Expression Systems:

    • Co-express atpB with other FO subunits (particularly c-ring components)

    • Use differentially tagged subunits for verification of complex formation

    • Success Rate Data:

      • Single subunit expression: 40-60% soluble protein recovery

      • Coordinated multi-subunit expression: 70-85% soluble complex recovery

  • Pull-Down Assays with Intact Complexes:

    • Express atpB with affinity tag in native organisms or heterologous hosts

    • Purify intact complexes under gentle conditions

    • Identify interacting partners by mass spectrometry

    • Evidence: Successful implementation with bacterial ATP synthases from E. coli and Bacillus PS3

Biophysical Interaction Analysis:

  • Microscale Thermophoresis (MST):

    • Label one component (typically atpB) with fluorescent dye

    • Measure thermophoretic mobility changes upon interaction with other subunits

    • Determine binding affinities and kinetics

    • Advantage: Requires small sample amounts and works well with membrane proteins

  • Surface Plasmon Resonance (SPR):

    • Immobilize atpB on sensor chip surface

    • Flow other components across and measure binding

    • Challenge: Proper orientation of membrane proteins requires specialized surfaces

Chemical Biology Approaches:

  • Photo-Crosslinking:

    • Incorporate photo-activatable amino acids at specific positions in atpB

    • Activate crosslinking upon complex formation

    • Identify crosslinked partners by mass spectrometry

    • Recent Development: Site-specific incorporation of photo-methionine provides highly specific crosslinking

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse biotin ligase to atpB

    • Identify proximity partners through biotinylation

    • Advantage: Works in living cells under native conditions

Functional Reconstitution:

Studying functional interactions requires reconstitution of components into proteoliposomes:

  • Sequential Reconstitution Protocol:

    • First incorporate c-ring into liposomes

    • Add subunit a (atpB)

    • Finally add peripheral stalk and F1 components

    • Measure ATP synthesis activity as verification of proper complex assembly

  • Mutational Complementation:

    • Generate partial complexes with specific mutations in key subunits

    • Test for functional complementation upon addition of wild-type components

    • Evidence: This approach revealed the assembly pathway of ATP synthase in yeast, suggesting a modular assembly process involving independent assembly of the c-ring, F1, and a/A6L subcomplexes

Data Analysis Considerations:

When interpreting interaction data, researchers should consider:

  • The detergent/lipid environment's impact on interaction affinities

  • Potential artifacts from tags and fusion proteins

  • The dynamic nature of some interactions during the catalytic cycle

Recent advancements in native mass spectrometry and cryo-EM have greatly enhanced our ability to study intact ATP synthase complexes, revealing previously unappreciated details of subunit interactions within the membrane domain .

How might research on Anaeromyxobacter sp. ATP synthase inform the development of novel antimicrobials?

Research on Anaeromyxobacter sp. ATP synthase could significantly contribute to antimicrobial development strategies:

Structural Basis for Selective Targeting:

  • Species-Specific Structural Features:

    • Detailed structural analysis of Anaeromyxobacter sp. atpB compared to other bacterial species can reveal unique binding pockets

    • Comparative structural biology approaches can identify regions present in bacterial ATP synthases but absent in human mitochondrial ATP synthases

    • These differences can be exploited for selective inhibitor design

  • Translation to Pathogenic Species:

    • Insights from Anaeromyxobacter sp. ATP synthase can inform understanding of ATP synthases in pathogenic deltaproteobacteria

    • Structural and functional homology modeling can predict conservation of binding sites across species

Mechanistic Understanding for Drug Development:

  • Novel Binding Site Identification:
    Recent success with ATP synthase inhibitors targeting mycobacteria demonstrates the potential of this approach:

    • Bedaquiline targets the c-ring of mycobacterial ATP synthase

    • Structural studies have revealed species-specific elements like the mycobacterial γ-loop and αCTD that could serve as selective targets

    • Similar unique features in Anaeromyxobacter sp. ATP synthase could inspire new inhibitor classes

  • Ion Channel Blockers:

    • Detailed understanding of the ion translocation pathway in atpB can guide development of ion channel blockers

    • Compounds targeting the interface between subunit a and the c-ring could disrupt energy coupling

Research Strategy Framework:

  • Target Validation Experiments:

    • Determine essentiality of ATP synthase in related pathogenic species

    • Classify organisms based on their energetic dependencies (obligate aerobes vs. facultative anaerobes)

    • Establish correlations between ATP synthase structure and inhibitor sensitivity

  • Screening and Design Pipeline:

    • In silico screening against homology models of pathogens based on Anaeromyxobacter sp. structures

    • Biochemical validation using reconstituted systems

    • Cellular validation in bacterial cultures

Emerging Research Directions:

Recent findings demonstrate that ATP synthase is essential in:

  • Obligate aerobes (e.g., Mycobacterium tuberculosis)

  • Obligate anaerobes (e.g., Clostridioides difficile)

  • Aerotolerant anaerobes

This suggests two promising approaches:

  • Direct targeting of ATP synthase in organisms where it is essential

  • Combination therapy approaches where ATP synthase inhibitors sensitize bacteria to other antimicrobials through disruption of membrane potential

Research on Anaeromyxobacter sp. ATP synthase could contribute valuable knowledge to both strategies .

What are the potential applications of engineered Anaeromyxobacter sp. ATP synthase variants in synthetic biology and biotechnology?

Engineered Anaeromyxobacter sp. ATP synthase variants offer significant potential for synthetic biology and biotechnology applications:

Bioenergetic Applications:

  • Minimal Energy Systems:

    • If Anaeromyxobacter sp. ATP synthase operates at low driving forces (like other anaerobic bacteria at ~90 mV), engineered variants could:

      • Power synthetic cells with minimal energy input

      • Function in energy-limited environments

      • Create highly efficient energy conversion systems

    • Research Direction: Engineer variants with optimized c-ring stoichiometry to further reduce the ion-to-ATP ratio

  • Ion Specificity Modifications:

    • Engineer variants that switch between H+ and Na+ specificity

    • Create dual-specificity enzymes for flexible energy harvesting

    • Experimental Approach: Target key residues in the ion binding sites based on comparative analysis with known H+- and Na+-specific ATP synthases

Nanobiotechnology Applications:

  • Molecular Motors and Nanomachines:

    • ATP synthase is a natural rotary motor with extraordinary efficiency

    • Engineered variants could power:

      • Nanodevices for controlled molecular transport

      • Sensors with mechanical readouts

      • Microscale mixing devices

    • Evidence: The F1 portion of thermophilic bacterial ATP synthases has already been successfully used to create nano-rotary devices

  • Biosensing Platforms:

    • Engineer ATP synthase to respond to specific ligands by modulating its activity

    • Create sensors for:

      • Environmental toxins

      • Metabolic signals

      • Specific ions

Bioprocess Engineering:

  • ATP Regeneration Systems:

    • Create immobilized ATP synthase systems for regenerating ATP in cell-free biotransformation processes

    • Advantage: More efficient than traditional enzymatic ATP regeneration systems

  • Coupling to Artificial Electron Transport Chains:

    • Design systems that couple light harvesting or electrode-driven electron transport to proton pumping

    • Connect to ATP synthase for energy conversion and storage

    • Potential Application: Light-driven ATP synthesis in artificial cell systems

Technical Implementation Strategies:

  • Directed Evolution Approaches:

    • Design selection systems based on ATP synthesis-dependent growth

    • Screen for variants with desired properties:

      • Enhanced stability

      • Altered ion specificity

      • Lower energy thresholds

  • Rational Design Strategies:

    • Structure-guided mutagenesis targeting:

      • Ion binding sites in subunit a and c-ring

      • Interfaces between subunits to modify coupling efficiency

      • Regulatory regions to create controllable variants

  • Hybrid Systems:

    • Create chimeric ATP synthases with components from different species

    • Combine the low energy threshold capabilities of Anaeromyxobacter sp. with the stability of thermophilic enzymes

    • Evidence: Successful creation of hybrid ATP synthases between different bacterial species has been demonstrated

The natural adaptation of Anaeromyxobacter sp. to energy-limited anaerobic environments makes its ATP synthase particularly valuable for applications requiring high efficiency at low driving forces, representing a largely untapped resource for synthetic biology and bioenergetic engineering .

What controls and validation steps are essential when studying the assembly and function of recombinant ATP synthase complexes containing Anaeromyxobacter sp. subunit a?

Rigorous controls and validation steps are critical for reliable research on recombinant ATP synthase complexes containing Anaeromyxobacter sp. subunit a:

Expression and Purification Validation:

  • Protein Identity and Integrity:

    • Western blot analysis with subunit-specific antibodies

    • Mass spectrometry verification of intact protein and peptide mapping

    • N-terminal sequencing to confirm proper processing

    • Critical Control: Analysis of potential proteolytic degradation products

  • Membrane Insertion Assessment:

    • Membrane fractionation to verify localization

    • Protease accessibility assays to confirm topology

    • Expected Outcome: Protection of transmembrane domains from proteolysis

Complex Assembly Validation:

Functional Validation Framework:

  • ATP Hydrolysis Controls:

    • Positive Control: Properly assembled complex with expected activity

    • Negative Controls:

      • Heat-denatured enzyme

      • Complex with known inhibitor (e.g., oligomycin)

      • Inactive mutant (e.g., mutation in catalytic site)

  • ATP Synthesis Validation:

    • Essential Control Experiments:

      • No ATP synthesis without applied PMF

      • No synthesis without ADP/Pi

      • Inhibition by specific inhibitors

      • Ionophore sensitivity to confirm ion coupling

    • Quantitative Analysis: ATP synthesis rates should correlate with magnitude of applied PMF

Reconstitution Quality Controls:

  • Proteoliposome Characterization:

    • Size distribution by dynamic light scattering

    • Protein orientation by accessibility assays

    • Membrane integrity by carboxyfluorescein leakage tests

    • Critical Parameter: Protein:lipid ratio optimization with activity measurement

    • Expected Range: Optimal ratios typically 1:50 to 1:200 (w/w)

  • Ion Gradient Verification:

    • Direct measurement of established ion gradients

    • Stable gradient maintenance over experimental timeframe

    • Control Experiment: Ionophore addition should collapse gradient

Troubleshooting Strategy Table:

ObservationPotential CauseValidation TestSolution
Low ATP hydrolysis activityImproper foldingCD spectroscopy for secondary structureOptimize detergent conditions
Incomplete complexBN-PAGE analysisCo-expression of missing subunits
Inhibited stateAddition of uncouplersAdd specific activators
No ATP synthesisInsufficient PMFMeasure actual ΔpH/ΔψIncrease gradient magnitude
Inactive orientationAccessibility assaysOptimize reconstitution protocol
Improper c-ring assemblyAFM imaging of membrane fractionCo-expression with c-subunits
Unstable complexDetergent-induced dissociationDetergent screen with stability assaysAdd stabilizing lipids
Missing essential subunitsMass spectrometry analysisComplete complex reconstitution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.