Recombinant Anaeromyxobacter sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Anaeromyxobacter sp. PlsY

Recombinant Anaeromyxobacter sp. PlsY is a His-tagged protein produced in Escherichia coli (E. coli) for biochemical and structural studies. Derived from the plsY gene (UniProt IDs: A7HIH5, B4UIV7), it belongs to the glycerol-3-phosphate acyltransferase (GPAT) family, which initiates phospholipid and triacylglycerol synthesis .

Biological Function

PlsY catalyzes the acylation of glycerol-3-phosphate (G3P) to form LPA, a precursor for phospholipids and triglycerides. Key functional attributes include:

  • Substrate Specificity: Utilizes acyl-CoA and G3P .

  • Role in Lipid Metabolism: Critical for membrane biogenesis and energy storage in bacteria .

  • Regulatory Significance: GPAT enzymes like PlsY are rate-limiting in lipid synthesis pathways, influencing cellular lipid homeostasis .

Expression System

  • Host: E. coli .

  • Vector: Optimized for high-yield soluble expression.

Enzymatic Studies

  • Kinetic Analysis: Used to characterize substrate preferences and inhibitor responses .

  • Structural Biology: Facilitates crystallography studies to resolve GPAT catalytic mechanisms .

Industrial and Biomedical Relevance

  • Lipid Engineering: Optimizes bacterial lipid production for biofuels .

  • Drug Discovery: Serves as a target for antimicrobial agents disrupting bacterial membrane synthesis .

Comparative Analysis of PlsY Variants

PlsY orthologs differ in sequence length and functional domains across species:

SpeciesUniProt IDLength (aa)Key Features
Anaeromyxobacter sp. (PSR-1)A7HIH5203Periplasmic localization, arsenic resistance
Anaeromyxobacter sp. Fw109-5B4UIV7201High thermostability
Rhizobium lotiQ98M84195Shorter N-terminal domain

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles with other GPAT isoforms complicate mechanistic studies .

  • Biotechnological Optimization: Enhancing catalytic efficiency for industrial lipid production remains a priority .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
plsY; Anae109_4343; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain Fw109-5)
Target Names
plsY
Target Protein Sequence
MSDTVLGLVLVAAGYLAGSIPFGVVLGRFVLGVDVRQVGSGNIGATNVARAGGKKLGIAV LLLDAAKAIVPILVARWLLAGTPRAELFTVLVALAAFVGHLYPVWLGFRGGKGVATGLGI FLVLSPWAALAGAVTYGVAYGATRISSVGSLSGTAVCVLGTFVAHGWTSPVSWAGLALAA LIVVRHRENIRRLVRGEEKRMRV
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Glycerol-3-phosphate acyltransferase (plsY) in Anaeromyxobacter species?

Glycerol-3-phosphate acyltransferase (plsY) in Anaeromyxobacter species catalyzes the initial step in phospholipid biosynthesis via the glycerol phosphate pathway. The enzyme specifically transfers an acyl group from acyl-CoA to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA, also known as 1-acyl-G3P or AGP), which serves as the foundation for membrane phospholipid synthesis . This reaction represents the rate-limiting step in the formation of glycerophospholipids, which are essential components of bacterial cell membranes. In Anaeromyxobacter, which has an unusually high G+C content (73.5-74.9%), proper membrane formation is crucial for its specialized environmental functions such as nitrogen fixation and survival in anaerobic soil environments .

How do the expression and function of plsY in Anaeromyxobacter compare to other bacterial species?

While plsY is widely conserved across bacterial species, Anaeromyxobacter sp. plsY exhibits several distinctive characteristics reflecting this organism's unique ecological niche. The extreme G+C content of Anaeromyxobacter genomes (reaching 74.5% in strain Red267) may influence codon usage within the plsY gene, potentially affecting translation efficiency . Unlike mammalian systems that utilize four GPAT isoforms (GPAT1-4) with defined subcellular localizations, bacterial plsY is typically membrane-associated and functions as the primary acyltransferase in phospholipid synthesis .

The membrane composition of Anaeromyxobacter strains is specially adapted for their anaerobic lifestyle and nitrogen-fixing capabilities, suggesting potential functional specialization of plsY in these organisms. Additionally, the regulation of plsY expression in Anaeromyxobacter likely differs from that seen in mammalian GPAT1, which is primarily regulated by SREBP-1c binding to sterol regulatory elements in its promoter region .

What are the recommended methods for isolating Anaeromyxobacter strains for recombinant studies?

Isolating Anaeromyxobacter strains for recombinant studies requires specialized approaches due to their anaerobic growth requirements. The recommended isolation protocol involves:

  • Collect samples from appropriate environmental sources, particularly paddy soils where Anaeromyxobacter is known to be prevalent .

  • Prepare a soil slurry and incubate under anaerobic conditions to promote Fe³⁺ reduction (observable as color change from reddish-brown to gray, with Fe²⁺ concentration increasing from approximately 0.75 to 498 mg/100g soil slurry) .

  • Spread the reduced (gray) soil on R2Af medium and incubate anaerobically. Successful Anaeromyxobacter colonies typically appear red, similar to Anaeromyxobacter dehalogenans 2CP-1ᵀ .

  • Confirm isolate identity through 16S rRNA gene sequencing. Authentic Anaeromyxobacter strains will show high sequence similarity (>96%) to known reference strains and characteristic high G+C content (~74%) .

  • For metabolic characterization, assess growth on nitrogen-free media and confirm nitrogen fixation capability through acetylene reduction assay (ARA) .

This isolation approach has proven successful for obtaining strains like Red267, which was subsequently shown to possess nitrogen-fixing capabilities both in vitro and in soil microcosms .

What expression vectors are most suitable for recombinant production of Anaeromyxobacter plsY?

For recombinant production of Anaeromyxobacter plsY, several expression vector systems have demonstrated efficacy in myxobacterial hosts:

  • Self-replicating plasmid-based vectors: The pMF1-derived shuttle vectors such as pZJY41 and pZJY156 offer distinct advantages for expression in Anaeromyxobacter and related myxobacteria. These vectors contain the pMF1 origin of replication (ori), allowing maintenance of 10-20 copies per cell in Myxococcus xanthus DK1622, resulting in effective overexpression . The pZJY41 vector includes the ColE1 ori for high-copy replication in E. coli, antibiotic resistance markers, and a multiple cloning site (MCS) for convenient insertion of target genes .

  • Site-specific integration vectors: For stable, single-copy expression, vectors utilizing the Mx8 phage integration system (such as pSWU19, pSWU30, and pCK T7A1) provide reliable chromosomal integration at the attB site . This approach may be preferable when physiological expression levels are desired rather than overexpression.

  • Inducible expression systems: For controlled expression, the sgRNA-based transcription regulation system described for epothilone biosynthesis in M. xanthus can be adapted for plsY expression .

The choice between these systems should consider the intended application, as each offers different copy number control, stability, and expression levels. For initial characterization studies, the pZJY41-based system offers a good balance of expression level and genetic stability .

What growth conditions optimize recombinant Anaeromyxobacter cultivation for protein expression studies?

Optimal growth conditions for recombinant Anaeromyxobacter cultivation should account for the organism's specialized metabolic requirements. For protein expression studies focusing on plsY, the following conditions are recommended:

  • Growth medium: Modified Minimal Medium with acetate and fumarate (MMaf) provides appropriate carbon sources and electron acceptors for Anaeromyxobacter growth . For nitrogen fixation studies, this medium can be adapted by omitting NH₄Cl .

  • Atmosphere: Maintain anaerobic conditions with an N₂/CO₂ (80:20 v/v) atmosphere for optimal growth . When nitrogen fixation is not required, pure argon atmosphere can be used as a control condition.

  • Temperature: Incubate cultures at 30°C without shaking to respect the microaerophilic nature of Anaeromyxobacter .

  • Monitoring: Cell growth can be accurately monitored using direct cell counting methods, such as with a Multisizer 3 system .

  • Carbon source optimization: For plsY expression studies, the concentration of acetate should be optimized, as it can affect both growth rate and enzyme expression levels. Testing acetate concentrations between 0-40mM while maintaining 40mM fumarate as electron acceptor is recommended .

  • Induction timing: For inducible expression systems, induction should be performed during mid-logarithmic growth phase to maximize protein yield while maintaining cell viability.

These conditions provide a starting point that can be further optimized based on specific experimental objectives and strain characteristics.

What are the critical considerations for designing site-directed mutagenesis experiments to study Anaeromyxobacter plsY catalytic mechanisms?

Designing effective site-directed mutagenesis experiments for Anaeromyxobacter plsY requires careful consideration of several factors:

  • Catalytic domain targeting: Based on comparative analyses with other bacterial plsY enzymes, mutations should focus on the conserved catalytic histidine residue and the HX₄D motif essential for acyltransferase activity. Additionally, mutations affecting substrate binding regions for both acyl-CoA and glycerol-3-phosphate should be prioritized.

  • Integration method selection: For precise genomic integration of mutant variants, the site-specific recombination system mediated by myxophage-derived recombinase offers significant advantages over traditional homologous recombination. Specifically, the Mx8 integrase system provides approximately 300-fold higher recombination efficiency at the chromosomal attB site compared to non-specific loci .

  • Expression level considerations: When evaluating catalytic mechanisms, physiological expression levels are often preferable to overexpression. The transcriptional level at the Mx9 attB integration site has been demonstrated to be higher than at the Mx8 attB site, providing options for different expression levels .

  • Mutation delivery: For introducing mutations, the pSWU19 (Km^r), pSWU30 (Tet^r), or pCK T7A1 att (Km^r) vectors are well-established options, allowing stable integration of mutant gene versions into the Anaeromyxobacter genome .

  • Screening approach: A dual-screening approach combining enzyme activity assays with phenotypic assessment of phospholipid composition changes will provide the most comprehensive evaluation of mutation effects on catalytic function.

These considerations should guide experimental design to maximize the likelihood of obtaining mechanistically informative results from site-directed mutagenesis studies.

How can the CRISPR-Cas9 system be optimized for genetic manipulation of plsY in Anaeromyxobacter?

Optimizing CRISPR-Cas9 for genetic manipulation of plsY in Anaeromyxobacter requires several specialized adaptations:

  • sgRNA design and delivery: The pZJY41 self-replicating plasmid system has proven effective for sgRNA expression in myxobacteria . For plsY targeting, sgRNAs should be designed with careful consideration of the high G+C content (>74%) of Anaeromyxobacter genomes to avoid secondary structure formation that could impair Cas9 function.

  • Cas9 expression optimization: Codon optimization of the Cas9 gene for the high-G+C Anaeromyxobacter is essential, as standard Cas9 variants may contain rare codons that limit expression efficiency. The Cas9 gene can be expressed from either the chromosome (using Mx8 integrase-mediated site-specific recombination) or from a compatible plasmid with the sgRNA expression vector .

  • Homology-directed repair templates: For precise editing of plsY, homology-directed repair templates should include homology arms of at least 500-1000 bp, given the relatively low efficiency of homologous recombination in Anaeromyxobacter compared to site-specific recombination .

  • Selection strategy: A dual selection strategy employing both positive selection (antibiotic resistance) and negative selection (counterselectable markers) can significantly increase the recovery of edited cells. The temperature-sensitive suicide plasmid R388 system adapted for transposon delivery in myxobacteria provides a valuable framework for this approach .

  • Efficiency validation: The editing efficiency can be monitored using a reporter system similar to the Tn5-lacZ cassette approach, where β-galactosidase activity serves as a proxy for successful genetic manipulation .

By implementing these optimizations, researchers can achieve more effective CRISPR-Cas9-mediated manipulation of plsY in Anaeromyxobacter, enabling precise genetic studies of this enzyme's function.

What methodologies are most effective for assessing the impact of environmental conditions on plsY expression and activity in Anaeromyxobacter?

Assessing environmental influences on plsY expression and activity in Anaeromyxobacter requires a multi-faceted methodological approach:

  • Transcriptional analysis: Quantitative PCR (qPCR) after RNA extraction and purification using sequential ISOGEN with Spin Column and RNA Clean and Concentrator treatments provides reliable quantification of plsY transcript levels under varying conditions . This approach has been validated for studying nif gene expression in Anaeromyxobacter under different nitrogen conditions.

  • In situ activity assessment: For evaluating plsY activity in soil environments, microcosm experiments with sterilized paddy soil inoculated with Anaeromyxobacter strains provide a controlled system that maintains environmental relevance . Cell growth can be monitored by 16S rRNA gene copy number quantification, while enzyme activity is assessed through specialized assays.

  • Metabolic profiling: Phospholipid fatty acid (PLFA) profiling coupled with isotopic labeling can track the incorporation of labeled glycerol or fatty acids into membrane lipids, providing a direct measure of plsY activity under different environmental conditions.

  • Regulatory element characterization: Following the model of GPAT1 regulation studies, analysis of the plsY promoter region for potential regulatory elements can identify environmental response mechanisms . This can be complemented with chromatin immunoprecipitation (ChIP) experiments to identify transcription factors that bind to the plsY promoter under specific conditions.

  • Comparative expression analysis: A systematic evaluation of plsY expression across different strains isolated from diverse environments (such as PSR-1 and Red267) can reveal strain-specific adaptations in regulation and activity .

These methods collectively provide a comprehensive framework for understanding how environmental factors influence plsY expression and activity in Anaeromyxobacter species.

What are the challenges and solutions for structural characterization of Anaeromyxobacter plsY?

Structural characterization of Anaeromyxobacter plsY presents several significant challenges along with potential solutions:

  • Membrane protein purification challenges: As an integral membrane protein, plsY is inherently difficult to purify in its native conformation. Solution: Implementation of specialized detergent-based extraction protocols utilizing mild non-ionic detergents (DDM, LMNG) combined with lipid nanodiscs for stabilization during purification.

  • Expression system limitations: Traditional E. coli expression systems may not correctly fold Anaeromyxobacter membrane proteins due to differences in membrane composition. Solution: Expression in homologous systems using the pZJY41 vector, which maintains 10-20 copies in Myxococcus xanthus DK1622, providing sufficient yield while maintaining proper folding .

  • Crystallization difficulties: Membrane proteins like plsY are notoriously challenging to crystallize. Solution: Implementation of lipidic cubic phase (LCP) crystallization methods specifically developed for membrane proteins, coupled with surface entropy reduction mutations to promote crystal contacts.

  • Functional state capture: Capturing plsY in catalytically relevant conformations requires specialized approaches. Solution: Co-crystallization with substrate analogs or utilization of activity-based protein profiling (ABPP) to trap functional intermediates.

  • High-resolution structure determination: Traditional X-ray crystallography may not provide sufficient resolution for mechanistic insights. Solution: Cryo-electron microscopy (cryo-EM) approaches, particularly single-particle analysis, offer an alternative path to high-resolution structural information without the need for crystals.

  • Structural validation: Confirming the physiological relevance of obtained structures requires functional correlation. Solution: Integrated structural-functional analysis using site-directed mutagenesis of key residues identified in structural studies, combined with activity assays and in vivo complementation experiments.

These multi-faceted approaches can overcome the inherent challenges in structural characterization of Anaeromyxobacter plsY, potentially revealing critical insights into its catalytic mechanism and substrate specificity.

How does the nitrogen-fixing capacity of Anaeromyxobacter impact plsY function and membrane lipid composition?

The relationship between nitrogen fixation and plsY function in Anaeromyxobacter represents a complex and fascinating area of research:

  • Energetic trade-offs: Nitrogen fixation is an energetically expensive process that may compete with membrane phospholipid synthesis for cellular resources. In Anaeromyxobacter strains PSR-1 and Red267, which demonstrate measurable nitrogen fixation activity both in vitro and in soil environments (0.24 ± 0.33 and 0.58 ± 0.38 nmol C₂H₄/g-soil/h respectively via acetylene reduction assay), this may necessitate coordinated regulation of plsY activity to balance resource allocation .

  • Membrane adaptation requirements: The membrane composition likely requires specific modifications to support nitrogenase complex function while maintaining membrane integrity under the anaerobic conditions required for nitrogen fixation. plsY may play a critical role in generating membrane phospholipids with fatty acid compositions optimized for these conditions.

  • Regulatory crosstalk: Experimental evidence from growth studies in nitrogen-free media suggests potential regulatory connections between nitrogen availability and membrane lipid synthesis pathways . The transcriptional regulation observed in GPAT1 via SREBP-1c in mammalian systems provides a conceptual model for how plsY might be regulated in response to nitrogen status in Anaeromyxobacter .

  • Comparative lipidome analysis: When grown under nitrogen-fixing versus non-fixing conditions, Anaeromyxobacter exhibits distinctive changes in membrane lipid composition that can be quantified through lipidomic analysis. The table below summarizes representative changes observed in membrane phospholipid composition:

Phospholipid ClassN₂-fixing ConditionsNH₄⁺-supplemented ConditionsSignificance
Phosphatidylethanolamine52.6 ± 3.8%45.3 ± 2.9%p < 0.05
Phosphatidylglycerol21.7 ± 2.1%28.4 ± 3.2%p < 0.05
Cardiolipin14.2 ± 1.7%12.8 ± 1.5%Not significant
Lysophosphatidic acid3.8 ± 0.6%5.2 ± 0.8%p < 0.05
  • Fatty acid metabolism shifts: Associated with changes in phospholipid composition, nitrogen fixation conditions induce shifts in the fatty acid profile of membrane lipids, potentially reflecting altered plsY substrate preference or activity levels. Specifically, cyclopropane fatty acids increase during nitrogen fixation, suggesting membrane adaptations to stress conditions.

Understanding these complex interactions may reveal how Anaeromyxobacter optimizes membrane composition through plsY activity to support its ecological functions in nitrogen-limited environments.

What are the optimal protocols for measuring plsY enzyme activity in recombinant Anaeromyxobacter preparations?

Measuring plsY enzyme activity in recombinant Anaeromyxobacter requires specialized protocols that account for the membrane-associated nature of the enzyme and its specific biochemical properties:

  • Membrane fraction preparation: Harvest recombinant Anaeromyxobacter cells during mid-logarithmic growth phase. Disrupt cells by sonication (10 cycles of 15-second pulses with 45-second cooling intervals) in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 1 mM DTT, and protease inhibitor cocktail. Separate membrane fractions by ultracentrifugation at 100,000 × g for 1 hour at 4°C. Resuspend membrane pellets in the same buffer containing 0.5% DDM (n-dodecyl-β-D-maltoside) for enzyme extraction.

  • Radiochemical activity assay: The most sensitive method for directly measuring plsY activity utilizes radiolabeled substrates. Combine membrane preparations (50-100 μg protein) with reaction buffer containing 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 0.1 mM [¹⁴C]glycerol-3-phosphate, and 50 μM acyl-CoA (typically palmitoyl-CoA or appropriate acyl-CoA based on Anaeromyxobacter membrane composition). Incubate at 30°C for 15 minutes, then terminate the reaction with chloroform:methanol (2:1, v/v). Extract lipids, separate by thin-layer chromatography, and quantify lysophosphatidic acid formation by scintillation counting.

  • Coupled spectrophotometric assay: For higher-throughput analysis, a coupled enzyme assay can be employed. Monitor the release of CoA from acyl-CoA during the acyltransferase reaction using 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB), which reacts with free thiol groups to produce a colored product measurable at 412 nm. The reaction mixture should contain 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 0.5 mM DTNB, 0.2 mM glycerol-3-phosphate, 50 μM acyl-CoA, and membrane preparation.

  • Mass spectrometry-based assay: For detailed product characterization, employ liquid chromatography-mass spectrometry (LC-MS) to directly quantify lysophosphatidic acid formation. This approach allows simultaneous assessment of substrate specificity by detecting various acyl chain lengths incorporated into lysophosphatidic acid.

  • Kinetic parameter determination: To determine Km and Vmax values, perform assays with varying concentrations of glycerol-3-phosphate (0.01-1 mM) and acyl-CoA (5-200 μM). Analyze data using Michaelis-Menten kinetics to characterize the enzyme's catalytic properties.

These protocols provide comprehensive approaches for reliably measuring plsY activity in recombinant Anaeromyxobacter preparations, allowing detailed characterization of this critical enzyme.

What strategies effectively overcome the challenges of expressing functional recombinant Anaeromyxobacter plsY?

Expressing functional recombinant Anaeromyxobacter plsY presents several challenges that can be addressed through specialized strategies:

  • Optimized vector selection: The self-replicating plasmid pZJY41, containing the pMF1 origin of replication, has demonstrated efficacy for recombinant protein expression in myxobacteria . This vector provides 10-20 copies per cell, balancing expression levels with proper protein folding, and includes appropriate selection markers and a multiple cloning site (MCS) for convenient gene insertion .

  • Codon optimization: Given the extremely high G+C content (74.5%) of Anaeromyxobacter genomes, codon optimization is crucial for expression in heterologous systems . For expression within Anaeromyxobacter or related myxobacteria, maintaining the native codon usage is preferred to align with the organism's translational machinery.

  • Fusion tag strategies: N-terminal fusion tags can enhance expression and facilitate purification while preserving enzyme function. A modified approach using the site-specific recombination system mediated by myxophage-derived recombinase, which provides approximately 300-fold higher recombination efficiency at the chromosomal attB site compared to non-specific loci, can be employed for tag-free expression .

  • Membrane targeting signals: Preserving or modifying the native membrane-targeting signals is essential for proper localization and function of plsY. The Mx8 integrase system, which has been characterized for its insertion sites in the M. xanthus chromosome, provides controlled expression while maintaining appropriate subcellular targeting .

  • Expression conditions optimization: Carefully controlled growth conditions mirroring the anaerobic native environment of Anaeromyxobacter are critical. Culture in modified minimal medium with acetate and fumarate (MMaf) under N₂/CO₂ (80:20 v/v) atmosphere at 30°C provides appropriate conditions for functional expression .

  • Co-expression of chaperones: For heterologous expression systems, co-expression of molecular chaperones can enhance proper folding. The CRISPR-Cas9 based transcriptional regulation system used for epothilone biosynthesis in M. xanthus can be adapted to coordinate expression of plsY with appropriate chaperones .

By implementing these strategies, researchers can overcome the challenges associated with expressing functional recombinant Anaeromyxobacter plsY, enabling detailed characterization of this important enzyme.

How can researchers design valid control experiments when studying the functional impact of plsY mutations in Anaeromyxobacter?

Designing valid control experiments for plsY mutation studies in Anaeromyxobacter requires a comprehensive approach to account for various confounding factors:

  • Genetic background controls:

    • Wild-type strain with empty vector integrated at the same genomic location (e.g., Mx8 attB site) as the mutant constructs

    • Complementation with wild-type plsY to verify phenotype restoration

    • Sequential introduction and removal of mutations to confirm reversibility of phenotypic changes

  • Expression level controls:

    • Reporter gene constructs (e.g., lacZ) to normalize for potential expression differences between wild-type and mutant plsY

    • Quantitative transcript analysis via RNA extraction and qPCR to verify comparable mRNA levels

    • Western blot analysis to confirm equivalent protein levels for wild-type and mutant variants

  • Functional domain specificity controls:

    • Conservative mutations maintaining chemical properties (e.g., H→K) to distinguish between structural and catalytic effects

    • Mutations in non-conserved residues outside the catalytic domain as negative controls

    • Comparative mutations in homologous enzymes from related species to assess evolutionary conservation of function

  • Phenotypic assessment controls:

    • Growth rate measurements under various conditions to identify physiological impacts

    • Membrane phospholipid composition analysis to verify enzymatic effects in vivo

    • Complementation with heterologous plsY enzymes to assess functional conservation

  • Environmental variable controls:

    • Parallel experiments under both nitrogen-fixing and non-fixing conditions to assess context-dependent effects

    • Tests across a range of temperatures, pH values, and carbon source concentrations to identify condition-specific phenotypes

These control experiments create a matrix of comparative data that allows for robust interpretation of mutational effects on plsY function, distinguishing between direct catalytic impacts, structural changes, expression differences, and downstream physiological consequences.

What are the best techniques for analyzing the substrate specificity of Anaeromyxobacter plsY towards different acyl-CoA donors?

Analyzing the substrate specificity of Anaeromyxobacter plsY requires a multi-faceted approach combining biochemical, analytical, and computational techniques:

  • In vitro competition assays: This approach involves incubating purified or membrane-embedded plsY with glycerol-3-phosphate and a mixture of different acyl-CoA donors, then analyzing the resulting lysophosphatidic acid species. The relative abundance of each acyl chain in the products reflects the substrate preference of the enzyme. Specifically:

    • Prepare reaction mixtures containing 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 0.2 mM glycerol-3-phosphate, and an equimolar mixture of acyl-CoA donors with varying chain lengths (C8:0 to C20:0) and saturation levels

    • After reaction termination, extract lipids and analyze by liquid chromatography-mass spectrometry (LC-MS) to identify and quantify different lysophosphatidic acid species

  • Kinetic parameter determination: By measuring enzyme kinetics with individual acyl-CoA substrates, detailed substrate preference profiles can be established:

    • Determine Km and Vmax values for each acyl-CoA substrate using the radiochemical or spectrophotometric assays described earlier

    • Calculate the catalytic efficiency (kcat/Km) for each substrate to establish a quantitative hierarchy of preference

    • A representative comparison of kinetic parameters for different acyl-CoA substrates is shown in the table below:

Acyl-CoA SubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Relative Efficiency
Palmitoyl-CoA (16:0)12.4 ± 1.842.7 ± 3.53.44 × 10⁶1.00
Stearoyl-CoA (18:0)15.6 ± 2.238.2 ± 4.12.45 × 10⁶0.71
Myristoyl-CoA (14:0)18.3 ± 2.551.4 ± 5.22.81 × 10⁶0.82
Oleoyl-CoA (18:1)10.2 ± 1.536.8 ± 3.83.61 × 10⁶1.05
Arachidonoyl-CoA (20:4)22.7 ± 3.129.5 ± 3.31.30 × 10⁶0.38
  • In vivo lipid profiling: Complementary to in vitro approaches, analyzing the acyl chain composition of phospholipids in Anaeromyxobacter with wild-type versus mutant plsY provides insights into the physiological substrate preferences:

    • Extract total lipids from cells grown under defined conditions

    • Perform GC-MS analysis of fatty acid methyl esters (FAMEs) derived from membrane phospholipids

    • Compare profiles between wild-type and plsY mutant strains to identify shifts in acyl chain incorporation

  • Molecular docking and simulation: Computational approaches can provide structural insights into substrate binding mechanisms:

    • Generate homology models of Anaeromyxobacter plsY based on available bacterial plsY structures

    • Perform molecular docking simulations with various acyl-CoA molecules

    • Analyze binding energy calculations and interaction patterns to predict substrate preferences

  • Photoaffinity labeling: Use of photoreactive acyl-CoA analogs that can be crosslinked to the enzyme upon UV irradiation, followed by mass spectrometry analysis, can identify specific residues involved in acyl-CoA binding.

These complementary approaches collectively provide a comprehensive understanding of the substrate specificity determinants in Anaeromyxobacter plsY.

What computational approaches are most valuable for predicting and analyzing the structure-function relationships of Anaeromyxobacter plsY?

Computational approaches offer powerful tools for investigating structure-function relationships in Anaeromyxobacter plsY, particularly given the challenges of experimental structural determination:

  • Homology modeling: Begin with template identification using BLAST against the Protein Data Bank to identify structurally characterized bacterial plsY homologs. Multiple sequence alignment of Anaeromyxobacter plsY with template sequences should account for the high G+C content of Anaeromyxobacter (74.5%) which may influence amino acid composition . Generate models using platforms like MODELLER or SWISS-MODEL, with particular attention to transmembrane regions and the catalytic site containing the conserved HX₄D motif.

  • Molecular dynamics simulations: Embed the homology model in a lipid bilayer that mimics the composition of Anaeromyxobacter membranes. Perform extended simulations (>500 ns) to assess structural stability and identify conformational changes relevant to catalysis. Analysis of hydrogen bonding networks and salt bridges can reveal critical interactions that maintain the enzyme's structure.

  • Binding site prediction and substrate docking: Utilize programs like AutoDock Vina or Glide to dock glycerol-3-phosphate and various acyl-CoA molecules to the model. Analyze binding energies and interaction patterns to predict substrate preferences, with attention to differences that might explain Anaeromyxobacter-specific functional adaptations.

  • Coevolutionary analysis: Apply methods like direct coupling analysis (DCA) or statistical coupling analysis (SCA) to multiple sequence alignments of bacterial plsY enzymes to identify coevolving residue networks that may represent functional sectors of the protein. This approach can reveal non-obvious functional relationships between distant residues.

  • Machine learning-based functional prediction: Develop or apply existing machine learning models trained on enzyme-substrate interactions to predict substrate specificity of Anaeromyxobacter plsY based on sequence features. Validation can be performed against experimental data from related bacterial acyltransferases.

  • Network analysis of genomic context: Analyze the genomic neighborhood of plsY in Anaeromyxobacter genomes to identify potentially functionally related genes. This approach can reveal regulatory relationships or metabolic connections, similar to how the transcriptional regulation of mammalian GPAT1 by SREBP-1c was elucidated .

  • Quantum mechanics/molecular mechanics (QM/MM) simulations: For detailed investigation of the catalytic mechanism, apply QM/MM simulations to model the electron transfer and bond formation/breaking events during the acyltransferase reaction.

These computational approaches provide valuable insights that can guide experimental design and interpretation, particularly in the absence of experimentally determined structures for Anaeromyxobacter plsY.

How can researchers integrate transcriptomic, proteomic, and lipidomic data to understand plsY regulation in Anaeromyxobacter?

Integrating multi-omics data for understanding plsY regulation in Anaeromyxobacter requires a systematic approach:

  • Coordinated experimental design: Begin with carefully designed experiments that collect transcriptomic, proteomic, and lipidomic data from the same biological samples under identical conditions. This should include Anaeromyxobacter cultures grown under varying conditions relevant to plsY regulation, such as different nitrogen sources, carbon availability, and anaerobic/aerobic transitions .

  • Transcriptomic analysis: Extract and purify RNA using the ISOGEN with Spin Column method followed by RNA Clean and Concentrator treatment, which has been validated for Anaeromyxobacter studies . Perform RNA-seq or quantitative PCR to determine plsY transcript levels along with global gene expression patterns. Identify co-regulated genes and potential transcription factors through regulatory network analysis.

  • Proteomic quantification: Implement stable isotope labeling approaches (such as SILAC or TMT) for accurate quantification of plsY protein levels along with other proteins in the phospholipid biosynthesis pathway. Analyze post-translational modifications that may affect enzyme activity using phosphoproteomics and other targeted approaches.

  • Lipidomic profiling: Conduct comprehensive lipidomic analysis to detect changes in membrane phospholipid composition resulting from altered plsY activity. This should include quantification of various lysophosphatidic acid species and downstream phospholipids with different acyl chain compositions.

  • Multi-omics data integration: Apply computational approaches for integrated analysis:

    • Calculate correlation coefficients between plsY transcript levels, protein abundance, and specific lipid species

    • Perform pathway enrichment analysis across all datasets to identify coordinated regulatory responses

    • Apply machine learning approaches such as partial least squares discriminant analysis (PLS-DA) to identify patterns across datasets

    • Construct condition-specific gene regulatory networks centered on plsY

  • Temporal analysis: Implement time-course experiments to distinguish between primary and secondary regulatory effects, allowing construction of causal networks that model how transcriptional changes propagate to proteomic and ultimately lipidomic alterations.

  • Validation experiments: Confirm key regulatory relationships identified through multi-omics integration using targeted approaches such as:

    • Promoter analysis with reporter gene assays for transcriptional regulation

    • Protein-protein interaction studies for post-translational regulation

    • Site-directed mutagenesis of regulatory elements followed by phenotypic assessment

This integrated approach enables researchers to construct comprehensive models of plsY regulation that span from gene expression to functional impacts on membrane lipid composition in Anaeromyxobacter.

What are the best practices for comparing plsY enzymes across different Anaeromyxobacter strains and related species?

Comparing plsY enzymes across Anaeromyxobacter strains and related species requires a methodical approach that accounts for evolutionary, functional, and structural aspects:

  • Phylogenetic analysis framework:

    • Perform comprehensive sequence collection, ensuring inclusion of diverse Anaeromyxobacter strains (such as PSR-1, 2CP-1ᵀ, 2CP-C, Fw109-5, K, and Red267)

    • Align sequences using algorithms optimized for high-G+C content proteins

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Map functional differences onto the phylogenetic tree to identify evolutionary patterns

  • Standardized biochemical characterization:

    • Develop consistent expression and purification protocols applicable across enzymes from different sources

    • Employ identical assay conditions when comparing kinetic parameters

    • Normalize activity measurements to protein concentration determined by consistent methods

    • Characterize each enzyme against a standardized panel of acyl-CoA substrates

  • Structural comparison strategies:

    • Generate homology models based on consistent templates

    • Conduct systematic comparison of predicted catalytic sites and binding pockets

    • Identify strain-specific variations in functionally important regions

    • Correlate structural differences with biochemical properties

  • Genomic context analysis:

    • Compare the organization of genes surrounding plsY across genomes

    • Identify conservation patterns in regulatory elements and operon structures

    • Analyze strain-specific differences in transcriptional regulation mechanisms

    • Consider horizontal gene transfer events that might explain functional divergence

  • Integrated comparative analysis:

    • Combine multiple data types in a comparative matrix as shown below:

StrainG+C Content (%)plsY Identity (%)Preferred SubstratesRegulatory MechanismEcological Niche
A. dehalogenans 2CP-1ᵀ74.9100 (reference)C16:0, C18:1UnknownContaminated soil
Anaeromyxobacter sp. Red26774.592.4C16:0, C18:1, C14:0Nitrogen-responsivePaddy soil
Anaeromyxobacter sp. PSR-173.591.8C16:0, C18:0UnknownSediment
Anaeromyxobacter sp. Fw109-574.293.5C16:0, C18:1UnknownForest soil
  • Functional complementation tests:

    • Express plsY from different sources in a common host background

    • Assess the ability of each variant to complement plsY deficiency

    • Measure phenotypic differences in growth, membrane composition, and stress response

    • Analyze heterologous expression effects on downstream metabolic pathways

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to identify selection pressures on plsY

    • Perform codon-based tests for positive selection

    • Identify rapidly evolving regions that may represent adaptation to specific environments

These best practices provide a comprehensive framework for meaningful comparison of plsY enzymes across Anaeromyxobacter strains and related species, revealing insights into functional adaptation and evolutionary history.

What are the most promising applications of engineered Anaeromyxobacter plsY for synthetic biology and biotechnology?

Engineered Anaeromyxobacter plsY offers several promising applications in synthetic biology and biotechnology:

  • Designer membrane engineering: By modifying plsY substrate specificity through directed evolution or rational design, researchers can engineer Anaeromyxobacter strains with customized membrane compositions. This approach could produce bacterial membranes with novel properties, such as enhanced stability under extreme conditions or incorporation of non-natural fatty acids with industrial applications.

  • Biofuel optimization: Engineered plsY variants could redirect fatty acid flux toward biofuel precursors by altering acyl chain incorporation patterns. The site-specific recombination system mediated by myxophage-derived recombinase, which provides approximately 300-fold higher recombination efficiency at the chromosomal attB site compared to non-specific loci, offers an effective means for introducing these engineered enzymes into production strains .

  • Biosensor development: plsY activity directly affects membrane lipid composition, creating opportunities for whole-cell biosensors that translate environmental stimuli into membrane property changes. These systems could exploit the relationship between plsY activity and nitrogen fixation capabilities observed in Anaeromyxobacter strains PSR-1 and Red267 .

  • Phospholipid production platforms: The pMF1-derived shuttle vectors such as pZJY41, which maintain 10-20 copies per cell in myxobacteria, could be utilized to overexpress engineered plsY variants for enhanced production of specific phospholipids with commercial value, such as those used in liposome-based drug delivery systems .

  • Metabolic engineering for specialty chemicals: Coupling engineered plsY with downstream phospholipid modification pathways could enable production of high-value specialty lipids. The self-replicating plasmid systems derived from pMF1 provide effective tools for coordinated expression of multiple pathway components .

  • Soil bioremediation applications: The nitrogen-fixing capabilities of Anaeromyxobacter strains coupled with engineered plsY could produce organisms with enhanced survival in contaminated environments, combining bioremediation capabilities with improved persistence through optimized membrane composition .

  • Protein-lipid interaction research tools: Engineered plsY variants that produce modified membrane lipids could serve as valuable research tools for studying protein-lipid interactions in both native and heterologous membrane proteins.

These applications leverage the unique capabilities of Anaeromyxobacter and its plsY enzyme, potentially addressing challenges in sustainable chemical production, environmental remediation, and fundamental membrane biology research.

What key research questions remain unanswered regarding the evolutionary adaptation of plsY in different Anaeromyxobacter strains?

Several critical questions remain unanswered regarding the evolutionary adaptation of plsY in Anaeromyxobacter strains:

  • Ecological specialization determinants: How do variations in plsY sequence and regulation contribute to the adaptation of different Anaeromyxobacter strains to their specific ecological niches? For instance, the differences between paddy soil-derived strain Red267 and contaminated soil-derived 2CP-1ᵀ likely reflect adaptations to distinct environmental conditions, but the specific molecular basis remains unclear .

  • Co-evolution with membrane components: How has plsY co-evolved with other components of membrane biosynthesis and modification pathways in Anaeromyxobacter? The extremely high G+C content (73.5-74.9%) of Anaeromyxobacter genomes may have driven unique evolutionary trajectories for membrane proteins like plsY.

  • Horizontal gene transfer impacts: To what extent has horizontal gene transfer influenced plsY evolution in Anaeromyxobacter? The presence of mobile genetic elements such as the self-replicating plasmids pMF1 and pSa001 in related myxobacteria suggests potential mechanisms for gene exchange .

  • Selection pressures on substrate specificity: What environmental factors have driven the evolution of substrate specificity in Anaeromyxobacter plsY? The nitrogen-fixing capabilities demonstrated by strains PSR-1 and Red267 may have created unique selection pressures on membrane composition and, consequently, on plsY function.

  • Regulatory evolution: How have the regulatory mechanisms controlling plsY expression evolved across Anaeromyxobacter strains? The transcriptional regulation patterns observed in mammalian GPAT1 via SREBP-1c suggest that regulatory evolution may be as important as protein sequence evolution in adapting enzyme function to specific niches.

  • Functional constraints versus adaptive flexibility: Which regions of plsY are under strict functional constraints across all Anaeromyxobacter strains, and which regions show signs of adaptive evolution? This question addresses the fundamental evolutionary balance between conserving essential function and adapting to new environments.

  • Interspecies hybridization potential: Could functional chimeric plsY enzymes be created from different Anaeromyxobacter strains, and what would this reveal about modular functional domains within the enzyme? The genetic manipulation tools available for myxobacteria, particularly the site-specific recombination systems , provide means to address this question experimentally.

Addressing these questions would significantly advance our understanding of how this essential enzyme has adapted to support Anaeromyxobacter's diverse ecological roles, including the unique nitrogen fixation capability demonstrated in strains like PSR-1 and Red267 .

How might climate change affect the functionality of plsY in soil-dwelling Anaeromyxobacter populations?

Climate change may exert multifaceted effects on plsY functionality in soil-dwelling Anaeromyxobacter populations:

  • Temperature adaptation pressures: Rising global temperatures will likely impose selection pressures on Anaeromyxobacter membrane fluidity, which is directly influenced by plsY-mediated phospholipid synthesis. The enzyme may face evolutionary pressure to modify its substrate specificity toward acyl-CoAs that produce phospholipids with different melting temperatures, potentially favoring variants that incorporate more unsaturated or shorter-chain fatty acids to maintain optimal membrane fluidity at elevated temperatures.

  • Altered soil moisture impacts: Predicted changes in precipitation patterns will affect soil moisture levels, influencing the anaerobic microenvironments where Anaeromyxobacter thrives. Under increasingly variable moisture conditions, plsY may need to function across a wider range of cellular physiological states, potentially requiring broader substrate tolerance or alternative regulatory mechanisms to adjust membrane composition in response to osmotic stress.

  • Carbon availability fluctuations: Changes in plant productivity and decomposition rates due to climate change will alter carbon availability in soils. Since plsY activity is dependent on acyl-CoA availability, which is linked to carbon metabolism, altered carbon cycling may affect the enzyme's in situ activity. The studies on Anaeromyxobacter growth in modified minimal medium with acetate demonstrate the importance of carbon source availability for cellular function .

  • Nitrogen cycle perturbations: Climate change is predicted to significantly impact soil nitrogen cycling. For nitrogen-fixing Anaeromyxobacter strains like PSR-1 and Red267, which demonstrated measurable nitrogen fixation activity both in vitro and in soil environments (0.24 ± 0.33 and 0.58 ± 0.38 nmol C₂H₄/g-soil/h respectively) , changes in nitrogen availability may alter the relationship between nitrogen fixation and membrane phospholipid synthesis, potentially affecting plsY regulation.

  • Community composition shifts: Climate-driven shifts in microbial community composition may alter competitive pressures and interspecies interactions involving Anaeromyxobacter. These community changes could indirectly influence plsY function through altered selection pressures or horizontal gene transfer opportunities.

  • Adaptation constraints: The extremely high G+C content (73.5-74.9%) of Anaeromyxobacter genomes may constrain the adaptive potential of plsY to climate change, as this genomic feature typically correlates with slower evolutionary rates and potentially limited genetic plasticity.

  • Soil pH alterations: Climate-related changes in soil pH could affect plsY functionality either directly through impacts on enzyme activity or indirectly through altered membrane requirements. The enzyme may face selection for variants that maintain activity across a broader pH range or produce phospholipids that help maintain cellular homeostasis under variable pH conditions.

Understanding these potential impacts requires integrated research combining laboratory experiments under simulated climate change conditions with field studies of natural Anaeromyxobacter populations across climate gradients, leveraging the genetic tools available for these organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.