Recombinant Anaeromyxobacter sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; AnaeK_3672; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain K)
Target Names
mscL
Target Protein Sequence
MSFASEFKAFALKGNVVDLAVGVIIGAAFGKIVDSIVNDLVMPVVGAIFGGLDFKDYFVA LKEIPPGVPHALDAVKKAGVPVFAYGSFLTIVLNFLILAFIIFLMVKQFNRMKRAEPAPA PAAPPEQVVLLREIRDALRR
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Anaeromyxobacter sp. and how does it relate to other bacterial taxa?

    Anaeromyxobacter sp. represents a genus within the family Myxococcaceae in the class Myxobacteria, distinguished by its unique physiological characteristics. Unlike typical aerobic myxobacteria, Anaeromyxobacter species are capable of anaerobic growth and lack characteristic fruiting bodies while maintaining close phylogenetic relationships with the Myxococcus subgroup. Sequence analysis of 16S rDNA shows approximately 9.0% difference from other myxobacterial genera, which established its classification as a distinct genus . Anaeromyxobacter species are globally distributed in soil environments, particularly prevalent in paddy soils, and some strains have been isolated from contaminated environments where they may play important ecological roles in bioremediation processes .

  • What is the physiological role of MscL in bacterial cells?

    MscL (Large-conductance mechanosensitive channel) functions as an emergency release valve in bacteria, protecting cells against extreme turgor pressure during osmotic downshock. When bacteria experience sudden reductions in external osmolarity, water rapidly enters the cell, creating high membrane tension. MscL channels respond by opening large, water-filled pores that allow the rapid efflux of cytoplasmic solutes, thereby preventing cell lysis .

    Studies with MscL-deficient mutants in various bacterial species demonstrate that cells lacking these channels experience >10-fold loss of viability when subjected to hypoosmotic shock. Experimental evidence shows that the opening of these channels occurs at pressures just below those that would compromise cell integrity, highlighting their critical role in bacterial osmoregulation and survival .

Advanced Research Methodology

  • What expression systems are optimal for producing functional recombinant Anaeromyxobacter sp. MscL?

    The optimal expression system for Anaeromyxobacter sp. MscL production utilizes E. coli as the heterologous host with specific vectors and conditions:

    • Expression vector: pB10d vector (a modified pB10b plasmid) containing IPTG-inducible promoters (lac UV5 and lacIq), ampicillin resistance, and a C-terminal 6-His tag is recommended based on successful expression of homologous MscL proteins .

    • E. coli strain: BL21(DE3) or similar expression strains are preferred due to their reduced protease activity.

    • Expression conditions: Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8, followed by growth at 30°C for 4-6 hours has shown optimal results for similar MscL proteins.

    • Protein extraction: Membrane fractionation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations of 1-2% is effective.

    • Purification strategy: Immobilized metal affinity chromatography using the His-tag, followed by size exclusion chromatography to ensure homogeneity of the pentameric assemblies .

  • What techniques are most effective for studying the structural dynamics of MscL channels?

    Several complementary techniques have proven effective for studying MscL structural dynamics:

    1. Site-Directed Spin Labeling Electron Paramagnetic Resonance (SDSL EPR) Spectroscopy: This technique involves introducing cysteine mutations at specific positions, labeling with nitroxide spin labels, and measuring spectral parameters to determine mobility, solvent accessibility, and inter-subunit proximities. This approach has successfully resolved structural details of both closed and open conformations of MscL channels .

    2. Patch-Clamp Electrophysiology: This method allows direct measurement of channel activity in response to membrane tension. It can be used to determine conductance, gating thresholds, and kinetics of channel opening and closing .

    3. Molecular Dynamics (MD) Simulations: Computational modeling complements experimental data by providing insights into conformational changes during gating. MD simulations have been particularly valuable for understanding the dynamics of the C-terminal domain during channel opening .

    4. Stopped-Flow Light Scattering: This technique measures changes in cell volume during osmotic challenges and has been used to analyze the kinetics of osmolyte release mediated by MscL and other mechanosensitive channels .

  • How can researchers determine the oligomeric state of MscL in native membranes versus detergent solutions?

    Determining the oligomeric state of MscL requires multiple complementary approaches:

    1. In vivo disulfide-trapping technique: This method introduces cysteine residues at interfaces between subunits and monitors disulfide bond formation in native membranes. This approach has been critical in establishing that some MscL proteins maintain pentameric structures in vivo despite forming different oligomers in detergent solutions .

    2. Blue Native PAGE: This technique separates protein complexes in their native state and can distinguish between different oligomeric forms.

    3. Size Exclusion Chromatography combined with Multi-Angle Light Scattering (SEC-MALS): This approach accurately determines molecular weight of protein-detergent complexes in solution.

    4. Cross-linking studies: Chemical cross-linking followed by SDS-PAGE analysis can identify the number of subunits in the complex.

    5. Electron microscopy: Negative stain or cryo-EM techniques provide direct visualization of the channel structure and oligomeric state.

    Research has shown that detergent composition can significantly affect the observed oligomeric state, with some MscL homologs appearing as tetramers in detergent micelles while maintaining pentameric structures in native membranes . The C-terminal domain plays a significant role in maintaining pentameric assembly in some MscL homologs, though this appears to be species-dependent .

Functional Characterization

  • What methods can be used to assess the mechanosensitive properties of recombinant Anaeromyxobacter sp. MscL?

    Several complementary methods can effectively characterize mechanosensitive properties:

    1. Patch-Clamp Electrophysiology: This gold-standard technique allows direct measurement of channel activity in response to membrane tension. Protocols involve:

      • Reconstitution of purified MscL into liposomes or expression in giant spheroplasts

      • Application of negative pressure to excised membrane patches

      • Recording channel currents at different pressure levels to determine:

        • Pressure threshold for activation

        • Single-channel conductance

        • Gating kinetics and modes

        • Channel inactivation or adaptation properties

    2. Cell Viability Assays: These assess the physiological function of MscL channels:

      • Complementation studies in MscL-deficient E. coli strains

      • Survival assays following hypoosmotic shock (e.g., dilution from high to low osmolarity medium)

      • Quantification of cell lysis via measurement of released cellular contents (A260/A280 absorbing material)

    3. Stopped-Flow Light Scattering Experiments: These monitor the kinetics of osmolyte release:

      • Measurement of cell volume changes during osmotic downshock

      • Determination of release rates and correlation with channel activity

      • Assessment of swelling, release, and termination phases of osmoprotection

    4. Fluorescent Probes for Solute Efflux: Utilizing fluorescent reporters to monitor channel-mediated release of cellular contents in real-time .

  • How does the C-terminal domain influence MscL channel gating and stabilization?

    The C-terminal domain of MscL plays multiple roles in channel function:

    1. Structural stabilization: SDSL EPR spectroscopy and MD simulations reveal that the C-terminal domain forms a bundle of five α-helices aligned with the five-fold symmetry axis in the closed state. This structure helps stabilize the oligomeric assembly of the channel .

    2. Partial dissociation during gating: Experimental data and computational modeling demonstrate that only the top portion of the C-terminal domain (approximately residues 110-118) dissociates during channel gating, while the remainder maintains its assembled structure. This suggests a molecular sieve function while preserving oligomeric stability .

    3. Species-specific variations: Studies comparing different bacterial MscL proteins indicate that the role of the C-terminal domain varies between species. In some bacteria, like S. aureus, the C-terminal domain influences oligomeric state only when solubilized in detergent but not in native membranes .

    4. Interaction with cytoplasmic factors: The C-terminal domain may serve as an interaction site for cytoplasmic molecules that modulate channel function, though this aspect requires further investigation for Anaeromyxobacter sp. MscL specifically.

  • What is the relationship between MscL and other mechanosensitive channels in bacterial osmoregulation?

    The bacterial osmoregulatory system involves multiple mechanosensitive channels working in concert:

    1. Functional hierarchy: Studies have identified a functional relationship between MscL (high-threshold "emergency release valve") and other lower-threshold channels such as MscS and MscK. While MscL provides the largest conductance and final protection against extreme osmotic shock, it functions optimally in the presence of lower-threshold channels .

    2. Complementary roles: Experimental data with knockout strains reveal that:

      • MscS alone can often rescue cell populations from osmotic downshock

      • MscL without MscS and MscK may become ineffective or even toxic

      • Combined deletion of both MscL and MscS results in >10-fold reduction in viability during osmotic downshock

    3. Sequential activation: During osmotic downshock, channels activate in sequence based on their tension thresholds:

      • Lower-threshold channels (MscS, MscK) open first at moderate tension

      • Higher-threshold MscL channels activate if tension continues to increase

      • This graded response allows proportional solute release based on stress severity

    4. Termination mechanisms: MscS exhibits inactivation behavior different from the "leaky" deactivation of MscL. This difference appears critical for proper termination of the osmotic release process .

Comparative and Evolutionary Analysis

  • How do MscL channels from Anaeromyxobacter sp. compare with homologs from other bacterial species?

    Comparative analysis reveals several key similarities and differences:

    FeatureAnaeromyxobacter sp. MscLE. coli MscLM. tuberculosis MscLPsychrobacter sp. MscL
    Length140 amino acids136 amino acids151 amino acids143 amino acids
    Sequence identityReferenceModerate similarity36% identityModerate similarity
    Crystal structureNot determinedSimilar to M. tuberculosisPentamericNot determined
    TM domainsPredicted 2 domains2 domains2 domains2 domains
    N-terminal regionMSFASEFKSimilar motifUnique featuresMSMMSEFK
    C-terminal regionRich in alanine and prolineDifferent compositionForms cytoplasmic bundleDifferent composition
    Proposed oligomeric stateLikely pentamericPentamericPentamericLikely pentameric

    Sequence alignment shows conservation of key functional residues in the transmembrane domains while exhibiting more variation in the cytoplasmic regions. The Anaeromyxobacter sp. MscL contains characteristic motifs associated with mechanosensation but also has unique sequence features that may reflect adaptation to its specific environmental niche and physiological requirements .

  • What evolutionary insights can be gained from studying MscL in Anaeromyxobacter and other Myxobacteria?

    Studying MscL in Anaeromyxobacter provides several evolutionary insights:

    1. Ecological adaptation: Anaeromyxobacter species occupy unique ecological niches as anaerobic myxobacteria. The presence of MscL in these organisms suggests the importance of osmotic regulation even in anaerobic soil environments. Comparative analysis of MscL sequences across different Anaeromyxobacter strains from various environments (contaminated sites, paddy soils, etc.) could reveal adaptation signatures .

    2. Phylogenetic context: Within the Myxobacteria class, Anaeromyxobacter represents an interesting evolutionary branch that combines features of typical myxobacteria with unusual anaerobic metabolism. Analysis of MscL in this context can shed light on the evolution of osmoregulatory mechanisms across the transition from aerobic to anaerobic lifestyles .

    3. Conservation of essential functions: The presence of MscL across diverse bacterial phyla, including specialized organisms like Anaeromyxobacter, highlights the essential nature of mechanosensation and osmoprotection throughout bacterial evolution. Comparative genomic analysis shows that while many specialized metabolic pathways differ between bacterial species, mechanosensitive channels remain conserved core components .

    4. Lateral gene transfer vs. vertical inheritance: Analysis of MscL sequences across bacterial taxa can help determine whether these genes spread through horizontal gene transfer or were primarily vertically inherited. This provides insights into the evolutionary history of bacterial osmotic adaptation mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.