Recombinant Anaeromyxobacter sp. NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in Escherichia coli:

Production DetailsDescription
Expression SystemE. coli with N-terminal His-tag fusion
Purity>90% as verified by SDS-PAGE
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for long-term storage

Biological Role and Function

nuoA is integral to the bacterial NDH-I complex, which performs two critical roles:

  1. Electron Transport: Transfers electrons from NADH to quinone, initiating the respiratory chain.

  2. Proton Translocation: Generates a proton motive force (PMF) across the membrane, driving ATP synthesis .

In Anaeromyxobacter, NDH-I likely supports anaerobic respiration, where NADH is oxidized using fumarate or other terminal electron acceptors. This process is vital for energy conservation in environments lacking oxygen .

ELISA and Immunoassays

Recombinant nuoA is utilized as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect specific antibodies or study protein interactions:

ApplicationDetails
ELISA KitsAvailable in 50 µg quantities; optimized for immunoassay workflows
BufferTris-based buffer with 50% glycerol; stored at -20°C
Use CasesAntibody detection, epitope mapping, and protein interaction studies

Biochemical Studies

  • Proton Translocation: In Rhodobacter sphaeroides, complex I isozymes (e.g., clade A and E) drive PMF generation under aerobic/anaerobic conditions .

  • Genomic Context: nuoA genes are often part of polycistronic operons (nuoA to nuoN), ensuring coordinated expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; Anae109_1290; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain Fw109-5)
Target Names
nuoA
Target Protein Sequence
MLTPLQTYFPIAVALLVAVGLAAVMLALANVLGPRRPSEVKSTPFECGSLPVSPARERFS VKFYVVALLFIVFDIEAIFLYPWAVLLLPSDGYPGLGWAGYISMGIFVATLVAGLVYVWK KGVLDWAD
Uniprot No.

Target Background

Function
NDH-1 is a NADH-quinone oxidoreductase that transfers electrons from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in Anaeromyxobacter species?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the NADH dehydrogenase I complex (NDH-1) in the respiratory chain of Anaeromyxobacter species. It functions as part of the enzyme responsible for catalyzing the transfer of electrons from NADH to quinones (EC 1.6.99.5), which serves as the initial step in the electron transport chain . The nuoA protein is membrane-bound and contributes to energy conservation through the establishment of an electrochemical gradient across the membrane that drives ATP synthesis.

In Anaeromyxobacter species, this enzyme complex plays a crucial role in anaerobic respiration, similar to its function in other bacteria like Vibrio cholerae where the homologous Na⁺-translocating NADH:quinone oxidoreductase (NQR) generates the sodium motive force (SMF) . While the specific functions in Anaeromyxobacter have not been fully characterized in the provided materials, its important role in respiratory processes is evident from studies in related systems.

What expression systems and purification methods are recommended for recombinant Anaeromyxobacter sp. nuoA?

When expressing recombinant Anaeromyxobacter sp. nuoA, researchers should consider the following methodological approaches:

Expression Systems:

  • E. coli-based expression systems with specialized vectors designed for membrane proteins

  • Cell-free expression systems for difficult-to-express membrane proteins

  • Heterologous expression in yeast systems (S. cerevisiae or P. pastoris) for eukaryotic studies

Purification Protocol:

  • Cell lysis in the presence of mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using appropriate detergent concentrations

  • Affinity chromatography using the protein's affinity tag (determined during production)

  • Size-exclusion chromatography for final purification

  • Buffer exchange to a Tris-based storage buffer containing 50% glycerol

Storage Recommendations:

  • Store at -20°C for standard usage

  • For extended storage, maintain at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How do researchers distinguish between nuoA and other NADH-quinone oxidoreductase subunits?

Distinguishing nuoA from other subunits requires a multi-faceted approach:

TechniqueApplication to nuoAAdvantagesLimitations
Western blottingUses antibodies specific to nuoA or its affinity tagHigh specificityRequires validated antibodies
Mass spectrometryIdentifies unique peptide fragments of nuoAPrecise identification and quantificationComplex sample preparation
qPCRTargets nuoA gene with specific primersHighly sensitive for gene expression studiesMeasures mRNA, not protein levels
Genomic analysisUses primers specific to nuoA sequenceAllows detection in environmental samplesLimited to nucleic acid detection

Researchers can use molecular techniques such as quantitative PCR with specific primers and probes to distinguish nuoA from other subunits in genetic studies. For example, in studies of Anaeromyxobacter species, researchers have designed specific primers targeting distinct genes to differentiate between strains . Similar approaches can be applied to identify and quantify nuoA specifically.

For protein-level identification, mass spectrometry following tryptic digestion can identify signature peptides unique to nuoA. Additionally, the small size of nuoA (129 amino acids) distinguishes it from most other NADH-quinone oxidoreductase subunits on SDS-PAGE analysis.

What is the relationship between Anaeromyxobacter sp. nuoA and microbial energy metabolism?

The nuoA protein, as part of the NADH-quinone oxidoreductase complex, plays a central role in the energy metabolism of Anaeromyxobacter species. This relationship encompasses several key aspects:

  • Electron Transport Chain Initiation: nuoA contributes to the first enzyme complex in the respiratory chain, oxidizing NADH and transferring electrons to quinones.

  • Membrane Potential Generation: The electron transfer process is coupled to proton translocation across the membrane, contributing to the proton motive force or, in some bacteria, the sodium motive force .

  • Respiratory Versatility: Anaeromyxobacter species are known for their diverse respiratory capabilities, including the reduction of metals, nitrate, and other compounds. The NADH-quinone oxidoreductase complex provides reducing equivalents that ultimately feed these terminal electron-accepting processes .

  • Adaptation to Environmental Conditions: The regulation of respiratory complexes, including those containing nuoA, allows Anaeromyxobacter to adapt to varying electron acceptor availability in different environments.

In related bacteria like Vibrio cholerae, the homologous NQR complex is the main producer of the sodium motive force that drives processes including flagellar rotation, substrate uptake, ATP synthesis, and cation-proton antiport . Similar functions are likely in Anaeromyxobacter, although specific studies focusing on nuoA in this genus are needed to confirm these roles.

What methodological approaches are most effective for studying the role of nuoA in electron transfer to extracellular electron acceptors?

Studying nuoA's role in electron transfer to extracellular acceptors requires sophisticated experimental approaches that bridge biochemistry, electrochemistry, and microbiology:

Genetic Manipulation Approaches:

  • Gene Deletion/Complementation Studies: Create ΔnuoA mutants in Anaeromyxobacter and measure the impact on electron transfer to various acceptors including metals and nitrate. Complement with wild-type and modified nuoA genes to determine structure-function relationships.

  • Site-Directed Mutagenesis: Introduce specific mutations in conserved residues to identify amino acids critical for electron transfer activity or subunit interactions.

  • Heterologous Expression: Express Anaeromyxobacter nuoA in model organisms lacking endogenous activity to assess its specific contribution to electron transfer chains.

Biochemical and Biophysical Techniques:

  • Membrane Vesicle Studies: Prepare inside-out membrane vesicles containing nuoA-complex to measure electron transfer rates to quinones and artificial electron acceptors.

  • Protein-Protein Interaction Analysis: Use crosslinking, co-immunoprecipitation, or proximity labeling to identify interaction partners of nuoA within the respiratory chain.

  • Electron Paramagnetic Resonance (EPR): Track the formation and disappearance of radical intermediates during electron transfer events.

Electrochemical Methods:

  • Bioelectrochemical Systems: Develop electrode-based systems to measure electron transfer from cells expressing wild-type versus modified nuoA.

  • Protein Film Voltammetry: Immobilize purified complexes containing nuoA on electrodes to directly measure electron transfer properties.

Computational Approaches:

  • Molecular Dynamics Simulations: Model electron transfer pathways through the nuoA protein structure.

  • Quantum Mechanical Calculations: Calculate electron transfer rates between redox centers in the respiratory complex.

Researchers should consider combining these approaches to build a comprehensive understanding of nuoA's role in the broader context of Anaeromyxobacter's remarkable respiratory versatility, particularly its ability to reduce metals like uranium and iron .

How does the structure and function of Anaeromyxobacter sp. nuoA compare with homologous proteins in other bacteria with diverse respiratory capabilities?

A comparative analysis of nuoA across bacterial species reveals important evolutionary and functional relationships:

Bacterial SpeciesRespiratory CapabilitiesnuoA Homolog FeaturesFunctional Distinctions
Anaeromyxobacter sp.Metal reduction (Fe, U), nitrate reduction, versatile respiration129 aa, membrane-boundPotentially involved in metal reduction pathways
Vibrio choleraeNa⁺-driven respiration, aerobic/anaerobic flexibilityNqrA, part of Na⁺-translocating complexDrives sodium motive force rather than proton motive force
E. coliDiverse aerobic/anaerobic respirationNuoA, proton-translocatingWell-characterized proton pumping mechanism
Geobacter speciesExtensive extracellular electron transferNuoA homologEnhanced pathways for metal reduction

Structural Comparisons:
The nuoA protein belongs to a family of membrane proteins with multiple transmembrane domains. While the core structure is conserved across species, key differences exist particularly in:

  • Ion specificity determinants (H⁺ vs Na⁺)

  • Interaction interfaces with other subunits

  • Regions involved in quinone binding

Functional Adaptations:
Anaeromyxobacter species demonstrate remarkable respiratory versatility, including the ability to reduce U(VI), nitrate, ferric iron, and manganese oxide . This versatility suggests that the NADH-quinone oxidoreductase complex in these organisms may have evolved specific adaptations to efficiently couple with diverse terminal electron acceptor pathways.

Methodological Approaches for Comparison:

  • Multiple sequence alignment and phylogenetic analysis

  • Homology modeling based on available crystal structures

  • Heterologous expression of nuoA variants from different species

  • Chimeric protein construction to identify function-specific regions

This comparative approach provides insights into how the basic scaffold of nuoA has evolved to support diverse respiratory strategies across bacterial species, particularly those adapted to specialized environmental niches like metal-contaminated subsurface environments where Anaeromyxobacter strains have been identified .

What techniques are most effective for investigating the assembly and membrane integration of nuoA in the context of the complete NADH-quinone oxidoreductase complex?

Investigating nuoA assembly and membrane integration requires specialized techniques that address the challenges of membrane protein biology:

In vivo Assembly Monitoring:

  • Pulse-Chase Experiments: Label newly synthesized proteins and track their incorporation into the membrane and complex assembly over time.

  • Fluorescent Protein Tagging: Create fluorescent fusions of nuoA and other complex components to visualize assembly dynamics using advanced microscopy.

  • Split-Protein Complementation Assays: Detect protein-protein interactions during assembly using fragments of reporter proteins attached to putative interaction partners.

Membrane Integration Analysis:

  • Protease Accessibility Assays: Determine membrane topology by exposing membrane vesicles to proteases and analyzing protected fragments.

  • Substituted Cysteine Accessibility Method (SCAM): Introduce cysteines at various positions and probe their accessibility to membrane-impermeable sulfhydryl reagents.

  • Glycosylation Mapping: Introduce glycosylation sites to determine which regions are exposed to glycosylation machinery.

Complex Assembly Characterization:

  • Blue Native PAGE: Analyze intact complexes to determine assembly intermediates and final complex formation.

  • Sucrose Gradient Ultracentrifugation: Separate assembly intermediates based on size and density.

  • Mass Spectrometry of Crosslinked Complexes: Identify specific interaction interfaces between nuoA and other subunits.

Reconstitution Approaches:

  • In vitro Translation and Insertion: Use cell-free systems with added membranes or nanodiscs to study direct insertion.

  • Stepwise Reconstitution: Purify individual components and systematically reconstitute the complex to identify assembly dependencies.

  • Liposome Reconstitution: Insert purified components into artificial membrane systems to study functional assembly.

These methodological approaches can provide crucial insights into how nuoA integrates into membranes and assembles with other components to form a functional respiratory complex. This knowledge is particularly valuable given the importance of NADH-quinone oxidoreductase in energy conservation and the adaptation of Anaeromyxobacter to various environmental conditions.

How can nuoA and related respiratory proteins in Anaeromyxobacter be leveraged for bioremediation applications?

The respiratory capabilities of Anaeromyxobacter, partially enabled by nuoA-containing complexes, offer significant potential for bioremediation applications, particularly for metal contamination:

Uranium Bioremediation Applications:
Anaeromyxobacter species have been implicated in hexavalent uranium reduction and immobilization in contaminated environments . The respiratory chain, including NADH-quinone oxidoreductase, provides electrons for terminal reductases that convert soluble U(VI) to insoluble U(IV), effectively immobilizing this contaminant.

Research approaches to leverage this capability include:

  • Enhancing expression of respiratory components including nuoA

  • Optimizing electron transfer efficiency through protein engineering

  • Developing biostimulation strategies that target Anaeromyxobacter growth

Field Implementation Strategies:
Quantitative PCR targeting Anaeromyxobacter, including genus-specific and strain-specific approaches, has been used to monitor population dynamics during bioremediation . Data from the Oak Ridge Integrated Field-Scale Subsurface Research Challenge site demonstrated that:

  • Anaeromyxobacter abundance increased from <10⁵ cells/g sediment outside a biostimulation zone to 10⁸ cells/g sediment near injection wells

  • This increase correlated with decreased dissolved U(VI) concentrations

  • Different strains showed variable distribution and abundance in response to treatment

Methodological Considerations for Bioremediation Applications:

  • Strain Selection: Identify Anaeromyxobacter strains with optimal respiratory capacity and metal reduction rates.

  • Gene Expression Optimization: Engineer strains with enhanced expression of key respiratory components.

  • Community Management: Develop strategies to promote beneficial interactions between Anaeromyxobacter and other community members.

  • Monitoring Tools: Implement molecular tools to track strain abundance and activity, such as the multiplex quantitative real-time PCR approaches described for differentiating Anaeromyxobacter strains .

  • Electron Donor Selection: Optimize electron donor delivery to maximize the activity of respiratory complexes containing nuoA.

The relationship between respiratory metabolism and iron homeostasis in these organisms, as evidenced by studies in related systems , suggests that manipulation of iron availability could be an additional strategy to enhance bioremediation performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.