Recombinant Anaeromyxobacter sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Physiological Roles in Anaeromyxobacter sp.

Complex I in Anaeromyxobacter sp. supports diverse metabolic strategies:

Metabolic PathwayRole of Complex I
Aerobic RespirationOxidizes NADH from the TCA cycle to generate proton motive force (PMF)
Anaerobic RespirationReoxidizes NADH during dechlorination or nitrate reduction
PhototrophyReverse electron transport to synthesize NADH for CO₂ fixation (in some bacteria)

Example: In Anaeromyxobacter dehalogenans, complex I enables dechlorination of 2-chlorophenol using acetate as an electron donor .

Enzymatic Studies

  • Electron Transfer Mechanism: The N-terminal domain of nuoK interacts with the NADH-binding subunit (NuoE), facilitating electron transfer to the quinone pool .

  • Proton Translocation: Structural studies of NuoK’s membrane-embedded regions are critical for understanding proton pumping efficiency .

Biotechnological Potential

  • Bioremediation: Anaeromyxobacter’s complex I supports dechlorination and nitrate reduction, making it relevant for soil remediation .

  • Nitrogen Fixation: While nuoK is not directly involved, Anaeromyxobacter strains with nif genes (e.g., PSR-1, Red267) utilize complex I to maintain redox balance during N₂ fixation .

Comparative Analysis of Complex I Subunits

The table below highlights structural diversity in bacterial complex I subunits:

SubunitClade AClade EAnaeromyxobacter
NuoE262 aa166–457 aa~170 aa (N-terminal conserved)
NuoG493 aa894 aaContains N7 iron-sulfur cluster (stabilizes large subunits)
NuoCDSeparateFusedSeparate (clade-specific fusion absent)

Data synthesized from phylogenomic studies .

Challenges and Future Directions

  • Functional Elucidation: The exact role of nuoK in proton translocation remains unclear due to the complexity of membrane-embedded subunits.

  • Industrial Applications: Engineering nuoK for enhanced stability or catalytic efficiency could advance biofuel production or bioremediation technologies.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; AnaeK_4329; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain K)
Target Names
nuoK
Target Protein Sequence
MPVEYYLWLAAILFGIGLLGVLTKRNALILMMSVELMLNAANLTFLAFARRSGDLAGHAI AFFVIAVAAAEAAVGLAVVIAIYRSRGAINVDEVRVLSE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaeromyxobacter and why is it significant for studying nuoK?

Anaeromyxobacter is a facultative anaerobic bacterium belonging to the Myxococcales order in the Deltaproteobacteria class. It is globally distributed in soil environments, with particular predominance in paddy soils. Anaeromyxobacter species are significant for nuoK research due to their diverse metabolic capabilities, including metal reduction (iron, uranium), dechlorination of aromatic compounds, and various nitrogen transformation processes, including nitrogen fixation, nitrate reduction, and complete denitrification . These metabolic processes rely on efficient energy transduction systems like the NADH:quinone oxidoreductase complex (NDH-1), of which nuoK is a critical component. Anaeromyxobacter's ability to thrive in both aerobic and anaerobic conditions makes it an excellent model organism for studying respiratory chain components like nuoK under varying environmental conditions.

What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in bacterial metabolism?

The nuoK subunit (homologous to the mitochondrial ND4L subunit) is one of seven hydrophobic subunits in the membrane domain of the bacterial H⁺-translocating NADH:quinone oxidoreductase (NDH-1) complex. This enzyme catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane, a crucial process in cellular energy production . The nuoK subunit contains three transmembrane segments (TM1-3) and plays a vital role in the energy transduction mechanism. Two glutamic acid residues (Glu-36 in TM2 and Glu-72 in TM3) are particularly important for energy-coupled activity, with mutation of the highly conserved Glu-36 to alanine resulting in complete loss of NDH-1 activity . Thus, nuoK is essential for cellular respiration and energy generation in bacteria like Anaeromyxobacter.

How does the structure of nuoK contribute to its function in NDH-1 complex?

The nuoK subunit features three transmembrane segments (TM1-3) that are crucial for its functional integration within the NDH-1 complex. The spatial arrangement of these transmembrane helices positions two key glutamic acid residues (Glu-36 in TM2 and Glu-72 in TM3) in adjacent transmembrane segments, creating a potential proton translocation pathway . Additionally, the short cytoplasmic loop between TM1 and TM2 (containing Arg-25, Arg-26, and Asn-27) has been shown through mutation studies to be critical for energy transduction activities . The structural features of nuoK, particularly the positioning of charged residues within the hydrophobic membrane environment, facilitate proton movement across the membrane, contributing to the proton-pumping function of the NDH-1 complex. This structure-function relationship highlights how nuoK's relatively simple architecture plays a sophisticated role in cellular bioenergetics.

What are the optimal conditions for expressing recombinant nuoK protein in bacterial systems?

Based on experimental approaches used for similar membrane proteins, the following conditions have proven effective for recombinant nuoK expression:

ParameterOptimal ConditionNotes
Expression HostE. coli C43(DE3) or BL21(DE3)Strains designed for membrane protein expression
Growth MediumLB with appropriate antibioticKanamycin (50 μg/ml) for plasmids with kanamycin resistance
Pre-induction Temperature37°CFor optimal cell growth
Induction Temperature17-27°CLower temperatures reduce inclusion body formation
InducerIPTG (0.8 mM)Based on similar recombinant protein expression systems
Induction Duration4-8 hoursLonger times at lower temperatures
Rotary Speed (if using HARV vessels)15 rpmBased on optimal conditions for recombinant protein expression

For membrane proteins like nuoK, expression under simulated microgravity (SMG) conditions has shown increased recombinant protein productivity and higher plasmid copy numbers compared to normal gravity (NG) conditions . This approach leverages upregulation of ribosome/RNA polymerase genes and energy metabolism pathways, as well as protein folding modulators like chaperones, which help with proper folding of membrane proteins.

How can site-directed mutagenesis be used to study nuoK function in energy transduction?

Site-directed mutagenesis offers a powerful approach to investigate the functional importance of specific amino acid residues in nuoK. Based on established research protocols:

  • Target Selection: Focus on highly conserved residues like Glu-36 and Glu-72 in transmembrane segments, or the Arg-25/Arg-26/Asn-27 motif in the cytoplasmic loop .

  • Mutagenesis Strategy:

    • Conservative mutations (e.g., Glu → Asp) to preserve charge while altering side chain length

    • Non-conservative mutations (e.g., Glu → Ala) to eliminate functional groups

    • Position-shifting mutations (relocating key residues along a helix) to test spatial requirements

  • Functional Assays:

    • Electron transfer activity measurement (NADH oxidation rate)

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Quinone reductase activity measurement

Research has shown that when Glu-36 was shifted along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy-transducing NDH-1 activities, suggesting these positions maintain a functional environment for the glutamic acid residue . This approach can reveal the degree of positional flexibility versus strict conservation required for nuoK function.

What methods are effective for isolating and purifying recombinant nuoK from Anaeromyxobacter sp.?

Purification of recombinant nuoK presents challenges due to its hydrophobic nature as a membrane protein. The following methodological approach is recommended:

  • Cell Disruption:

    • Mechanical disruption via French press (15,000-20,000 psi)

    • Sonication (10 cycles of 30 seconds on/off at 40% amplitude)

    • Enzymatic lysis with lysozyme in hypotonic buffer

  • Membrane Fraction Isolation:

    • Differential centrifugation: low-speed (10,000 × g, 20 min) to remove cell debris

    • Ultracentrifugation (150,000 × g, 1 hour) to pellet membrane fraction

  • Detergent Solubilization:

    DetergentConcentrationAdvantagesLimitations
    n-Dodecyl-β-D-maltoside (DDM)1-2%Mild, preserves activityExpensive
    Triton X-1001%Effective solubilizationMay interfere with some assays
    Digitonin0.5-1%Maintains protein complexesLimited solubilization
  • Purification Methods:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged nuoK

    • Size exclusion chromatography to separate monomeric nuoK from aggregates

    • Ion exchange chromatography as a polishing step

  • Quality Assessment:

    • SDS-PAGE with Coomassie staining (expected size ~12-15 kDa)

    • Western blotting with anti-His or anti-nuoK antibodies

    • Mass spectrometry for protein identification

This purification strategy can be adapted depending on whether nuoK is being isolated as an individual subunit or as part of the intact NDH-1 complex.

How does nitrogen fixation capability in Anaeromyxobacter impact studies of nuoK and energy metabolism?

Anaeromyxobacter's recently confirmed nitrogen fixation capability introduces important considerations for nuoK research. The nitrogen-fixing ability of Anaeromyxobacter has been demonstrated through genomic analysis showing the presence of nitrogenase genes (nifBHDKEN), acetylene reduction activity (ARA), and N₂-dependent growth both in vitro and in soil environments .

This diazotrophic capability has significant implications for energy metabolism studies:

  • Energetic Demands: Nitrogen fixation is an energy-intensive process requiring substantial ATP, which places increased demands on the electron transport chain and thus on NDH-1 function.

  • Redox Balance: The need to maintain appropriate redox conditions for nitrogenase activity may influence electron flow through respiratory complexes including NDH-1.

  • Experimental Design Considerations:

    • Control of nitrogen availability is crucial when studying nuoK function in Anaeromyxobacter

    • Transcriptional analysis has shown that NH₄⁺ suppresses nitrogen fixation activity , which may indirectly affect nuoK expression or activity

    • Experiments should account for potential differences in nuoK expression or function under nitrogen-fixing versus non-fixing conditions

Researchers should consider these nitrogen metabolism interactions when designing experiments to study nuoK function in Anaeromyxobacter, particularly when comparing results across different nitrogen availability conditions.

What techniques are available for studying the dynamics of proton translocation through nuoK in real-time?

Advanced biophysical techniques have revolutionized our ability to study proton translocation through membrane proteins like nuoK in real-time:

  • Fluorescence-Based Techniques:

    • pH-sensitive fluorescent probes (BCECF, pHrodo)

    • Reconstitution of nuoK or NDH-1 complex into liposomes loaded with pH-sensitive dyes

    • Time-resolved fluorescence spectroscopy to detect proton movement with millisecond resolution

  • Electrophysiological Methods:

    • Solid-supported membrane (SSM) electrophysiology to measure charge translocation

    • Patch-clamp techniques applied to reconstituted systems

    • Electrical measurements in black lipid membranes containing purified nuoK

  • Spectroscopic Approaches:

    TechniqueInformation ProvidedTemporal Resolution
    FTIR difference spectroscopyProtonation state changesμs - ms
    Raman spectroscopyConformational dynamicsps - ns
    EPR spectroscopy with spin labelsDistance measurementsμs
    Solid-state NMRProton transfer pathwaysms - s
  • Computational Methods:

    • Molecular dynamics simulations of proton movement through nuoK

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for proton transfer energetics

    • Continuum electrostatics to map proton pathways

When applying these techniques to nuoK, particular attention should be paid to the roles of key residues Glu-36 and Glu-72, which mutation studies have shown to be critical for energy transduction . These residues likely participate directly in the proton translocation pathway.

How do various electron donors and acceptors affect nuoK function in Anaeromyxobacter compared to other bacteria?

Anaeromyxobacter's metabolic versatility, including its ability to use diverse electron donors and acceptors, provides a unique context for studying nuoK function. This comparison reveals important insights:

Electron Donors/AcceptorsEffect on nuoK in AnaeromyxobacterComparison with Other Bacteria
Electron Donors
NADHPrimary physiological substrate for NDH-1Similar across bacteria
H₂May reduce reliance on NADH-linked respirationLess common in non-hydrogenotrophic bacteria
AcetateKey carbon source in paddy soils ; affects energy metabolismIn E. coli, acetate concentration affects recombinant protein expression
Electron Acceptors
O₂Enables aerobic respiration via NDH-1Universal in facultative anaerobes
NO₃⁻/NO₂⁻Anaeromyxobacter can reduce via DNRA pathway Variable across bacterial species
Fe³⁺Anaeromyxobacter is a metal reducer ; may affect nuoK expressionLess common in many bacteria
N₂OAnaeromyxobacter reduces N₂O to N₂ Restricted to denitrifiers

Adaptations in nuoK structure or regulation in Anaeromyxobacter likely reflect evolutionary optimizations for function across these diverse electron transport scenarios. Research approaches should:

  • Compare nuoK expression levels under different electron donor/acceptor conditions

  • Assess nuoK mutant phenotypes across various respiratory modes

  • Analyze potential structural adaptations in Anaeromyxobacter nuoK that accommodate this metabolic versatility

  • Consider how post-translational modifications might regulate nuoK function in response to changing electron donors/acceptors

These comparative studies can reveal how nuoK's role in energy conservation may be fine-tuned across different bacterial species and metabolic conditions.

What are common challenges in expressing functional recombinant nuoK and how can they be addressed?

Researchers face several challenges when expressing recombinant nuoK due to its nature as a hydrophobic membrane protein. Here are key issues and solutions:

  • Protein Toxicity to Host Cells:

    • Problem: Overexpression of membrane proteins can disrupt host cell membranes

    • Solution: Use specialized expression strains (C43/C41), employ tight expression control, or consider simulated microgravity conditions which enhance recombinant protein production

  • Protein Misfolding and Aggregation:

    • Problem: Hydrophobic transmembrane segments prone to aggregation

    • Solution: Lower induction temperature (17°C), co-express with chaperones (GroEL/ES, DnaK), or use fusion partners (MBP, SUMO)

  • Low Expression Yields:

    • Problem: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codon usage, use stronger promoters cautiously, consider auto-induction media

  • Improper Membrane Insertion:

    IssueDetection MethodMitigation Strategy
    Incomplete insertionProtease accessibility assayOptimize signal sequence
    Incorrect topologyPhoA/LacZ fusion analysisModify hydrophobic regions
    Aggregation in inclusion bodiesFractionation analysisAdjust detergent solubilization
  • Functional Verification Challenges:

    • Problem: Difficult to verify if recombinant nuoK is functional

    • Solution: Co-express with minimal NDH-1 subunits for activity assays, use complementation of nuoK-deficient strains, or employ in vitro activity reconstitution

The experimental approach should be iterative, testing multiple conditions simultaneously and refining based on results. When studying conserved residues like Glu-36 and Glu-72 through mutagenesis, verify that expression levels are comparable between wild-type and mutant proteins to ensure functional differences aren't due to expression discrepancies .

How can researchers address contradictory findings in nuoK functional studies?

Contradictory results in nuoK research can arise from methodological differences, biological variability, or incomplete understanding of this complex membrane protein. A systematic approach to resolving contradictions includes:

  • Standardization of Experimental Methods:

    • Use consistent expression systems and conditions

    • Adopt standardized activity assays with appropriate controls

    • Document complete experimental parameters for reproducibility

  • Multi-angle Verification:

    • Confirm findings using complementary techniques

    • When mutation studies show unexpected results, verify protein expression and proper membrane insertion

    • Cross-validate between in vitro and in vivo approaches

  • Detailed Context Documentation:

    Contextual FactorImpact on ResultsDocumentation Practice
    Host organismBackground metabolism differencesSpecify strain genotype completely
    Growth conditionsMetabolic state affects activityRecord all media components, O₂ availability
    Purification methodDetergent effects on activityDocument all buffers and detergents
    Assay conditionspH/temperature sensitivityStandardize and report precisely
  • Collaborative Approaches:

    • Establish consortium studies with multiple labs using identical protocols

    • Develop shared reagents and standardized assays

    • Create open repositories of raw experimental data

When specific contradictions arise, such as different effects of the same mutation across studies, researchers should examine whether the contradiction reflects genuine biological complexity rather than experimental error. For example, the findings that relocation of Glu-36 along TM2 retained activity might initially appear to contradict its essential nature, but actually reveals important insights about positional flexibility within a functional range.

What are the challenges in translating findings between in vitro studies of nuoK and its function in intact Anaeromyxobacter cells?

Bridging the gap between in vitro biochemical studies of nuoK and its physiological role in Anaeromyxobacter presents several challenges:

  • Structural and Functional Context:

    • In vitro limitation: Isolated nuoK or reconstituted systems lack the complete structural environment of the intact NDH-1 complex

    • Solution approach: Gradual complexity reconstruction, from purified nuoK to sub-complexes to whole NDH-1 to membrane vesicles

  • Physiological Electron Transfer Partners:

    • In vitro limitation: Artificial electron donors/acceptors may not replicate natural kinetics

    • Solution approach: Identify and incorporate physiological electron carriers specific to Anaeromyxobacter

  • Environmental Conditions Translation:

    ConditionIn Vitro ChallengeIn Vivo Reality
    pHOften buffered/constantDynamic/compartmentalized
    Membrane potentialArtificial/absentCritical for function
    Proton gradientManually establishedDynamically maintained
    Cellular redox stateSimplifiedComplex and homeostatic
  • Genetic Approach Integration:

    • Create nuoK mutants in Anaeromyxobacter based on in vitro findings

    • Assess phenotypes under varied conditions (aerobic/anaerobic, different electron acceptors)

    • Measure growth rates, substrate utilization, and bioenergetic parameters

    • Correlate with biochemical findings from in vitro studies

When studying Anaeromyxobacter specifically, consider its unique metabolic capabilities including nitrogen fixation , which may create specific energy demands affecting NDH-1 function. The nitrogen-fixing ability demonstrated both in vitro and in soil environments suggests that nuoK function should be studied under both nitrogen-sufficient and nitrogen-limiting conditions to fully understand its physiological role.

How might the nitrogen-fixing capacity of Anaeromyxobacter influence studies of recombinant nuoK expression and function?

The recently validated nitrogen-fixing capability of Anaeromyxobacter opens new research avenues for understanding nuoK function in the context of diazotrophy:

  • Energetic Trade-offs:

    • Nitrogen fixation is highly energy-intensive, requiring at least 16 ATP molecules per N₂ reduced

    • This creates a potential regulatory relationship between nitrogen fixation and electron transport chain components like nuoK

    • Studies should examine whether nuoK expression or post-translational modifications change under nitrogen-fixing conditions

  • Experimental Design Considerations:

    Nitrogen ConditionExpected EffectResearch Opportunity
    N₂-fixing modeIncreased energy demandStudy nuoK under high ATP demand
    NH₄⁺ supplementationSuppressed N₂ fixation Compare nuoK function across conditions
    Intermediate N limitationTransition stateStudy regulatory mechanisms
  • Expression System Optimization:

    • When expressing recombinant nuoK, nitrogen availability may affect expression efficiency

    • The demonstration that nitrogen fixation is important for Anaeromyxobacter to survive in nitrogen-deficient environments suggests potential adaptations in energy metabolism under N limitation

    • Expression protocols may need modification when working with nitrogen-fixing versus non-fixing conditions

  • Novel Research Questions:

    • Does nuoK structure or composition differ between diazotrophic and non-diazotrophic Anaeromyxobacter strains?

    • Are there specific interactions between nitrogen fixation regulatory systems and nuoK expression?

    • Can nuoK mutations affect nitrogen fixation capacity through energetic coupling?

Understanding these relationships could provide insights not just into nuoK function, but into the broader coordination between nitrogen and energy metabolism in bacteria.

What insights from simulated microgravity studies might be applied to enhance recombinant nuoK production?

Simulated microgravity (SMG) conditions have shown promise for enhancing recombinant protein production. Based on research with β-glucuronidase expressing E. coli , several principles could be applied to nuoK expression:

  • Enhanced Transcription and Translation:

    • SMG upregulates ribosome/RNA polymerase genes and energy metabolism pathways

    • Application: Design expression vectors with promoters responsive to SMG-induced transcription factors

  • Improved Protein Folding:

    • Protein folding modulators like chaperones are upregulated under SMG

    • Application: Co-express nuoK with specific chaperones identified in SMG studies

  • Optimized Experimental Parameters:

    ParameterOptimal SMG ConditionTraditional Condition
    Rotary speed15 rpm Varies by system
    Temperature17°C post-induction Often 18-37°C
    Induction time4-8 hours Often 3-24 hours
    MediumStandard LB with kanamycin Various formulations
  • Technical Implementation:

    • High Aspect Ratio Vessels (HARVs) provide an accessible laboratory system for SMG simulation

    • Rotation perpendicular to the gravity vector creates low-shear modeled microgravity

    • This environment may be particularly beneficial for membrane proteins like nuoK that are challenging to express

Applying SMG conditions could potentially overcome some of the traditional challenges in membrane protein expression, particularly for complex proteins like nuoK that require precise folding and membrane insertion for functionality.

How might structural studies of nuoK inform the development of bioenergetic systems for biotechnology applications?

Structural and functional studies of nuoK provide valuable insights for bioenergetic system engineering:

  • Bioinspired Energy Conversion:

    • The proton-pumping mechanism of nuoK involves critical glutamic acid residues in specific transmembrane positions

    • This architectural principle could inform design of artificial proton-conducting channels

    • Understanding how charged residues function within hydrophobic membrane environments enables biomimetic membrane design

  • Protein Engineering Opportunities:

    nuoK FeaturePotential ApplicationEngineering Approach
    Conserved Glu-36Enhanced proton pumpingOptimize surrounding residues
    TM1-TM2 loopControl mechanismsModify regulatory elements
    Transmembrane orientationDirectional ion flowAdjust membrane insertion dynamics
  • Synthetic Biology Integration:

    • Modular components based on nuoK structure could be incorporated into designer electron transport chains

    • Creation of hybrid energy-transducing systems with optimized efficiency

    • Development of biosensors based on conformational changes in nuoK during function

  • Emerging Technologies:

    • Bioelectrochemical systems incorporating modified nuoK proteins

    • Bioenergy production platforms with enhanced electron transfer efficiency

    • Bioremediating systems leveraging Anaeromyxobacter's diverse metabolic capabilities

The demonstration that specific residue positions and orientations within nuoK are critical for function provides a blueprint for designing artificial systems with controlled proton translocation capabilities, potentially leading to next-generation bioenergetic technologies.

What are the most promising future research directions for recombinant Anaeromyxobacter nuoK studies?

The intersection of Anaeromyxobacter's metabolic versatility with advances in membrane protein research creates several promising research frontiers:

  • Structural Biology Integration:

    • Apply cryo-electron microscopy to determine high-resolution structures of nuoK within the NDH-1 complex

    • Use molecular dynamics simulations to model proton movement through the nuoK subunit

    • Develop nuoK-based synthetic proton channels with engineered properties

  • Systems-Level Understanding:

    • Investigate how nuoK function integrates with Anaeromyxobacter's nitrogen fixation capability

    • Map regulatory networks connecting energy conservation and diverse metabolic modes

    • Develop metabolic models predicting energy flux through NDH-1 under varying conditions

  • Biotechnological Applications:

    Application AreaPotential DevelopmentResearch Need
    BioremediationEngineered Anaeromyxobacter with optimized energy efficiencynuoK variants for different environments
    BioelectronicsBacterial-electronic interfaces using NDH-1 componentsStable nuoK incorporation into artificial membranes
    Synthetic biologyDesigner electron transport chainsStructure-function relationships in nuoK
  • Methodological Advances:

    • Development of specialized expression systems for membrane proteins like nuoK

    • Application of simulated microgravity approaches to enhance recombinant production

    • Creation of high-throughput screening systems for nuoK variants

The convergence of detailed molecular understanding of nuoK function with appreciation of Anaeromyxobacter's ecological importance creates opportunities for both fundamental science advances and practical applications.

How might contradictory findings in nuoK research be systematically addressed through collaborative approaches?

Addressing contradictions in nuoK research requires coordinated strategies:

  • Standardization Initiatives:

    • Develop consensus protocols for recombinant nuoK expression and purification

    • Establish reference strains and constructs available to all researchers

    • Create standardized activity assays with defined parameters

  • Multi-laboratory Validation Studies:

    • Organize coordinated studies where multiple laboratories perform identical experiments

    • Systematically identify sources of variation in results

    • Create shared databases of experimental conditions and outcomes

  • Centralized Resources:

    Resource TypeFunctionImplementation
    Data repositoryRaw data archivingOpen-access database
    Materials bankStandardized reagentsCentralized distribution
    Methods registryProtocol standardizationOnline platform with version control
  • Advanced Analytical Approaches:

    • Machine learning to identify patterns in contradictory datasets

    • Bayesian analysis to incorporate prior knowledge and uncertainty

    • Systems biology modeling to predict context-dependent behavior

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.