Recombinant Anaeromyxobacter sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Function

Recombinant Anaeromyxobacter sp. Undecaprenyl-diphosphatase (uppP) is a recombinant enzyme produced through bacterial expression systems, primarily in E. coli. It catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) and inorganic phosphate, playing a critical role in peptidoglycan biosynthesis in bacteria . This enzyme belongs to the hydrolase family (EC 3.6.1.27) and is membrane-associated, with structural homologs in E. coli (PDB: 5OON, 6CB2) .

Key Biochemical Features:

ParameterDetailSource
Enzymatic ReactionUPP + H₂O ↔ UP + phosphate
CofactorsEnhanced activity with Ca²⁺ ions
FunctionRegenerates UP for lipid carrier recycling in cell wall synthesis
Bacitracin ResistanceConfers resistance by preventing UPP accumulation

Expression Systems and Tags

The recombinant uppP protein is typically expressed in E. coli with an N-terminal His-tag for purification. Full-length (1–292 amino acids) and partial variants are available, depending on experimental requirements .

Production Parameters:

FeatureDetailSource
Expression HostE. coli (in vitro expression)
TagN-terminal His-tag (10xHis in some variants)
Purity>90% (SDS-PAGE) for full-length; >85% for partial constructs
SolubilityLyophilized powder stored in Tris/PBS-based buffer (pH 8.0)

Functional Studies

  • Peptidoglycan Synthesis: UppP regulates the availability of lipid carriers (UP/UPP) for glycopeptide antibiotic resistance and cell wall assembly .

  • Bacitracin Resistance: Overexpression of uppP in E. coli enhances bacitracin resistance by depleting UPP pools .

Challenges in Functional Studies

  • Membrane Association: Full-length recombinant uppP may require lipid membranes for optimal activity .

  • Species-Specific Variations: Anaeromyxobacter spp. exhibit divergent uppP sequences compared to E. coli, necessitating strain-specific validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
uppP; AnaeK_0164; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Anaeromyxobacter sp. (strain K)
Target Names
uppP
Target Protein Sequence
MSLVSAALFGLLQALTEFLPVSSTAHLLVFGELLGHSLDDRRFRAFVTIIQAGTTLAVLV YFRADIARLVAASARGLARGRPFGTPEARLGWYIVLGTLPAALAGKLLEHRIEALGNWVI AGSLVALGLVLLAAERLASHRRRVEDVGAGDALLIGVAQALALVPGSSRSGTTITGGMLL GFTREAAARFSFLLSVPITLAAGAYKLWSTVPDLRGEAAWTVATVVGTVVSAVAGYLVID WLLAWLRTRTTYVFVVWRLAAGAAIAALILSGVLPAGAEAPPPPPPALHAAP
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function in bacteria?

Undecaprenyl-diphosphatase (uppP), enzyme classification EC 3.6.1.27, functions primarily as a phosphatase that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (Und-P). This reaction is crucial in the bacterial cell wall synthesis pathway, specifically in the lipid II cycle. The enzyme converts the initially synthesized UPP lipid carrier to Und-P, which serves as the substrate for the synthesis of lipid-linked precursors in peptidoglycan and wall teichoic acid synthesis. The conversion of UPP to Und-P represents a rate-limiting step in bacterial cell envelope biogenesis, making uppP an essential enzyme for bacterial viability and cell envelope integrity .

What are the optimal storage conditions for recombinant Undecaprenyl-diphosphatase for research purposes?

For optimal stability and activity, recombinant Anaeromyxobacter sp. Undecaprenyl-diphosphatase should be stored in Tris-based buffer containing 50% glycerol at -20°C. For extended storage periods, maintaining the protein at -80°C is recommended to minimize degradation. When working with the protein, it should be aliquoted to avoid repeated freeze-thaw cycles, which can significantly reduce enzymatic activity and structural integrity. Working aliquots can be stored at 4°C for up to one week without significant loss of activity. The 50% glycerol in the storage buffer serves as a cryoprotectant that prevents damage to the protein during freezing while maintaining its native conformation .

How does Undecaprenyl-diphosphatase contribute to bacterial antibiotic resistance?

Undecaprenyl-diphosphatase plays a significant role in bacterial antibiotic resistance, particularly against bacitracin. Bacitracin exerts its antibacterial effect by binding to UPP, thereby preventing its dephosphorylation and disrupting cell wall synthesis. Bacteria can develop resistance to bacitracin through several mechanisms involving Undecaprenyl-diphosphatase:

  • Increased expression of UPP phosphatases (like BcrC in Bacillus subtilis)

  • Structural modifications in UPP phosphatases that enhance catalytic efficiency

  • Activation of sigma factors (like σM) that upregulate UPP phosphatase genes

In Bacillus subtilis, the σM-dependent cell envelope stress response activates the expression of bcrC, which encodes a UPP phosphatase that acts on the outer face of the membrane. This increased expression converts more UPP (the target of bacitracin) to Und-P, thereby reducing the available binding sites for bacitracin and conferring resistance. This mechanism highlights the importance of Undecaprenyl-diphosphatase as both an antibiotic target and a contributor to resistance mechanisms .

What methodological approaches are most effective for assessing Undecaprenyl-diphosphatase enzymatic activity in vitro?

For rigorous assessment of Undecaprenyl-diphosphatase enzymatic activity in vitro, researchers should implement a multi-faceted approach:

Phosphate Release Assay:
A colorimetric malachite green assay can quantify inorganic phosphate released during UPP dephosphorylation. The reaction mixture should contain:

ComponentConcentration
Purified uppP0.1-1 μg
UPP substrate50-100 μM
Reaction buffer (Tris-HCl pH 7.5)50 mM
MgCl₂5 mM
Triton X-1000.1%

The reaction is typically incubated at 30-37°C for 15-30 minutes before adding malachite green reagent to detect released phosphate.

Radiolabeled Substrate Method:
For higher sensitivity, [³²P]-labeled UPP can be used with thin-layer chromatography separation to track substrate conversion to Und-P. This method can detect enzymatic activity at sub-nanomolar concentrations.

Reconstituted Membrane Systems:
To better mimic the native environment, the enzyme should be incorporated into proteoliposomes or nanodiscs with defined lipid compositions that reflect bacterial membranes. This approach provides insights into how membrane composition affects enzymatic activity.

When performing these assays, researchers must consider the detergent-sensitive nature of the enzyme and optimize detergent concentrations to maintain both substrate solubility and enzyme activity. Validation with known inhibitors like bacitracin provides essential controls for assay specificity .

How does the function of Anaeromyxobacter sp. Undecaprenyl-diphosphatase compare with homologous enzymes from other bacterial species?

Comparative analysis of Undecaprenyl-diphosphatases across bacterial species reveals important functional and structural divergences:

SpeciesEnzymeMembrane TopologyCatalytic EfficiencyInhibitor Sensitivity
Anaeromyxobacter sp.uppPMultiple transmembrane domainsMedium-highData limited
Bacillus subtilisUppP7 transmembrane domainsHighModerate bacitracin sensitivity
Bacillus subtilisBcrCSurface-exposedMediumLow bacitracin sensitivity
E. coliBacA7 transmembrane domainsHighHigh bacitracin sensitivity

The Anaeromyxobacter sp. Undecaprenyl-diphosphatase shares sequence homology with other bacterial UPP phosphatases but exhibits distinct properties related to its natural anaerobic environment. While the core catalytic mechanism of dephosphorylating UPP to Und-P is conserved, the Anaeromyxobacter enzyme likely possesses adaptations that optimize function under anaerobic conditions.

Research in Bacillus subtilis has demonstrated functional redundancy between different UPP phosphatases (UppP and BcrC), with either enzyme capable of supporting bacterial viability. A third lipid phosphatase (YodM) with homology to diacylglycerol pyrophosphatases can also support growth when overexpressed, suggesting evolutionary convergence in UPP phosphatase function.

The membrane topology and substrate accessibility of these enzymes significantly influence their contribution to antibiotic resistance. For instance, BcrC in B. subtilis is presumed to act on the outer face of the membrane, directly competing with bacitracin for UPP binding, while other phosphatases may access UPP from different membrane orientations .

What gene manipulation techniques are most effective for studying Undecaprenyl-diphosphatase function in bacterial systems?

For investigating Undecaprenyl-diphosphatase function in bacterial systems, researchers should consider the following gene manipulation approaches:

CRISPR Interference (CRISPRi) System:
CRISPRi provides a powerful tool for investigating essential genes like uppP through targeted gene repression rather than deletion. An optimized CRISPRi system using:

  • dCas9 (nuclease-deficient Cas9)

  • Guide RNAs targeting the uppP promoter or coding sequence

  • Inducible expression systems (e.g., tetracycline-inducible promoters)

This approach allows titrated depletion of Undecaprenyl-diphosphatase activity to study phenotypic consequences without eliminating the essential function completely.

Depletion Strains:
For redundant UPP phosphatases, researchers can generate strains where:

  • One phosphatase gene is deleted

  • The second phosphatase is placed under an inducible promoter

  • Expression is gradually reduced by inducer withdrawal

This approach has successfully demonstrated that B. subtilis requires either UppP or BcrC for viability, revealing their functional redundancy in the lipid II cycle.

Site-Directed Mutagenesis:
To study structure-function relationships, targeted mutations can be introduced to:

  • Catalytic residues

  • Membrane-interacting domains

  • Regulatory regions

For example, mutations in the presumed active site can help determine catalytic mechanisms, while modifications to transmembrane regions can assess importance of membrane localization.

Complementation Experiments:
When studying homologs from different species, researchers can express the Anaeromyxobacter sp. Undecaprenyl-diphosphatase in depletion strains of model organisms to assess functional conservation and species-specific adaptations .

What cellular phenotypes result from disruption of Undecaprenyl-diphosphatase activity, and how can they be quantitatively measured?

Disruption of Undecaprenyl-diphosphatase activity leads to several distinct cellular phenotypes that can be quantitatively assessed:

Cell Morphology Alterations:
Depletion of UPP phosphatase activity results in characteristic morphological defects consistent with cell envelope synthesis failure. These include:

  • Cell enlargement

  • Irregular cell shapes

  • Incomplete cell division

Quantification Method: Phase-contrast and fluorescence microscopy with membrane and cell wall stains, followed by automated image analysis to measure:

  • Cell length/width ratios

  • Frequency of morphological abnormalities

  • Cell division site placement

Cell Envelope Stress Response Activation:
UPP phosphatase depletion strongly activates stress response pathways, particularly the σM-dependent cell envelope stress response in Bacillus subtilis.

Quantification Method: Reporter gene fusions (e.g., lacZ or fluorescent proteins) under the control of stress-responsive promoters can measure activation of specific regulons. Key readouts include:

  • σM regulon activation (measured by PbcrC-lacZ reporter constructs)

  • Expression levels of other cell envelope stress genes

  • Temporal dynamics of stress response activation

Cell Wall Synthesis Disruption:
Reduced UPP phosphatase activity impairs peptidoglycan and teichoic acid synthesis.

Quantification Method:

  • Incorporation assays using radiolabeled cell wall precursors

  • Muropeptide analysis by HPLC to detect alterations in peptidoglycan composition

  • Cell wall thickness measurements using electron microscopy

Antibiotic Susceptibility Changes:
Alterations in UPP phosphatase levels modify susceptibility to cell wall-targeting antibiotics.

Quantification Method: Standardized minimum inhibitory concentration (MIC) determinations for:

  • Bacitracin (directly targets UPP)

  • Other cell wall-active antibiotics (vancomycin, β-lactams)

  • Control antibiotics with different mechanisms of action

These phenotypic analyses should be conducted across varying levels of UPP phosphatase depletion to establish dose-response relationships between enzyme activity and cellular consequences .

How does current research on Undecaprenyl-diphosphatase contribute to antibiotic development strategies?

Research on Undecaprenyl-diphosphatase contributes significantly to antibiotic development through multiple strategic approaches. The essential nature of UPP phosphatases for bacterial viability, coupled with their absence in mammalian cells, positions these enzymes as attractive targets for novel antimicrobials. The lipid II cycle, in which Undecaprenyl-diphosphatase participates, is one of the most frequently targeted processes for antibiotics, with bacitracin being a well-established example that binds to UPP to prevent its dephosphorylation.

Structure-based drug design targeting Undecaprenyl-diphosphatase can yield inhibitors that disrupt bacterial cell wall synthesis without affecting human cells. Detailed enzymatic mechanisms and crystal structures of UPP phosphatases provide templates for rational design of small molecule inhibitors with improved specificity and reduced toxicity compared to conventional antibiotics.

Additionally, understanding the functional redundancy between different UPP phosphatases (like UppP and BcrC in B. subtilis) reveals the need for broad-spectrum inhibitors that can target multiple phosphatase variants simultaneously to overcome potential resistance mechanisms. The discovery that depletion of UPP phosphatase activity strongly activates cell envelope stress responses also suggests that combination therapies targeting both the enzyme and stress response pathways could enhance antimicrobial efficacy.

Researchers have increasingly employed CRISPR interference techniques to identify and validate drug targets in the lipid II cycle, including UPP phosphatases. This approach has successfully identified inhibitors of UppS (the enzyme that synthesizes UPP) and could similarly yield effective inhibitors of UPP phosphatases .

What future research directions are most promising for advancing our understanding of Undecaprenyl-diphosphatase in bacterial cell envelope homeostasis?

Several promising research directions will advance our understanding of Undecaprenyl-diphosphatase and its role in bacterial cell envelope homeostasis:

High-Resolution Structural Studies:
Obtaining crystal structures of Anaeromyxobacter sp. Undecaprenyl-diphosphatase in various conformational states would provide critical insights into:

  • Substrate binding mechanisms

  • Catalytic residues and reaction intermediates

  • Structural basis for inhibitor interactions

  • Membrane integration and topology

Systems Biology Approaches:
Integrating transcriptomics, proteomics, and metabolomics can reveal:

  • Regulatory networks controlling UPP phosphatase expression

  • Metabolic adaptations to UPP phosphatase depletion

  • Interactions between different cell envelope synthesis pathways

  • Stress response crosstalk mechanisms

Single-Cell Analysis:
Advanced microscopy and microfluidic techniques to investigate:

  • Cell-to-cell variability in UPP phosphatase expression

  • Temporal dynamics of cell envelope synthesis

  • Spatial organization of lipid II cycle components

  • Real-time monitoring of stress response activation

Synthetic Biology Applications:
Engineering bacteria with modified UPP phosphatases could enable:

  • Creation of strains with altered cell wall properties

  • Development of biosensors for cell envelope-targeting antibiotics

  • Exploration of minimal requirements for bacterial cell envelope synthesis

  • Testing evolutionary constraints on UPP phosphatase function

Comparative Studies Across Bacterial Species:
Examining UPP phosphatases in diverse bacteria would illuminate:

  • Evolutionary conservation and divergence

  • Species-specific adaptations in anaerobic vs. aerobic bacteria

  • Correlation between UPP phosphatase diversity and antibiotic resistance profiles

  • Potential for narrow-spectrum antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.