Recombinant Anaplasma marginale ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
atpB; AM1110; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Anaplasma marginale (strain St. Maries)
Target Names
atpB
Target Protein Sequence
MSPLEQFRVTKLLDIPALWGIDLSFTNCSLVMVLASVSSILLLCWALRKINVVPGPSQTA VELIYGFVANTLESNAGAEGLRYIPLVMTTFLFVLACNLVGILPFGFTATSHLSVTLALS LVVCTAITVIGFRHQGLHFLRIFLPEGTPLWLAPMMVFIKLFAYVARPVSLAIRLAANMI AGHTIIAVIADFVLKMHLVLAPLPFAFIMGLIAFEIFVAILQAYIFTVLTTVYLSDAVAG H
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: ama:AM1110

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does AtpB function in the ATP synthase complex of Anaplasma marginale?

AtpB functions as a critical component of the F0 sector of ATP synthase in Anaplasma marginale, forming part of the proton channel that drives ATP synthesis. The protein facilitates the translocation of protons across the membrane, creating the proton-motive force that drives the conformational changes in the F1 sector necessary for ATP synthesis.

In bacterial systems like Anaplasma marginale, AtpB helps maintain the proper coupling between proton flow and ATP synthesis. It contains conserved amino acid residues that are essential for coordinating this process, particularly in the interface between the membrane-embedded F0 sector and the catalytic F1 sector. The protein works in concert with other ATP synthase subunits to ensure efficient energy conversion .

Unlike some ATP synthase components that directly bind nucleotides, AtpB participates in the energy conversion process primarily through its role in proton translocation and maintenance of the proper structural arrangement of the ATP synthase complex.

What are the optimal expression systems for producing recombinant Anaplasma marginale AtpB?

For successful expression of functional recombinant Anaplasma marginale AtpB, the following methodological considerations are crucial:

E. coli Expression System:
E. coli remains the preferred expression system for Anaplasma marginale AtpB due to its high yield and relative simplicity. For optimal expression:

  • Use BL21(DE3) or Rosetta(DE3) strains to accommodate potential rare codon usage

  • Employ a vector with an N-terminal His-tag for purification, as demonstrated in successful expression protocols

  • Induce expression at lower temperatures (16-20°C) to enhance proper folding

  • Use 0.1-0.5 mM IPTG for induction at OD600 of 0.6-0.8

Alternative Expression Systems:

  • Insect cell systems may be considered for projects requiring post-translational modifications

  • Cell-free protein synthesis systems can be useful for rapid screening of functional variants

Table 1: Comparison of Expression Systems for Recombinant AtpB

ParameterE. coliInsect CellsCell-Free System
Expression yieldHighModerateLow-Moderate
Post-translational modificationsMinimalMore extensiveControllable
Membrane protein foldingChallenging, requires optimizationBetter for membrane proteinsVariable
Time to production2-3 days7-10 daysHours
CostLowHighHigh
ScalabilityExcellentGoodLimited

The choice of expression tags significantly impacts purification success. While the N-terminal His-tag has been validated for AtpB expression , researchers should avoid large fusion partners that might interfere with the membrane-spanning regions of the protein.

What purification strategies yield the highest purity and activity for recombinant AtpB?

Purification of recombinant Anaplasma marginale AtpB requires careful consideration of its membrane protein characteristics. A multi-step purification approach is recommended:

  • Initial Extraction:

    • Use mild detergents (0.5-1% DDM or LDAO) for membrane protein solubilization

    • Include 10-20% glycerol in buffers to stabilize the protein structure

    • Maintain pH between 7.4-8.0 to preserve protein stability

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged AtpB

    • Employ a gradient elution with 20-250 mM imidazole to reduce non-specific binding

    • Add 0.05-0.1% detergent in all purification buffers to prevent aggregation

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and improve homogeneity

    • Consider ion exchange chromatography as a polishing step

  • Quality Assessment:

    • SDS-PAGE analysis should confirm >90% purity as reported for recombinant AtpB preparations

    • Western blotting with anti-His antibodies to confirm identity

    • Circular dichroism to verify proper folding

For storage, lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been demonstrated to preserve stability. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

How can ATP binding and ATPase activities of recombinant AtpB be accurately measured?

Accurate assessment of ATP binding and ATPase activities requires rigorous experimental approaches:

ATP Binding Assays:

  • Photoaffinity Labeling Method:

    • Incubate purified recombinant AtpB with [α-32P]ATP or [γ-32P]ATP

    • UV-crosslink to stabilize ATP-protein interactions

    • Analyze by SDS-PAGE and autoradiography

    • Include competition assays with unlabeled nucleotides (ATP, GTP, dATP, dGTP) to determine binding specificity

  • Fluorescence-Based Approaches:

    • Utilize fluorescent ATP analogs like TNP-ATP or MANT-ATP

    • Monitor changes in fluorescence emission upon protein binding

    • Determine binding constants through titration experiments

ATPase Activity Assays:

  • Colorimetric Phosphate Detection:

    • Measure release of inorganic phosphate using malachite green or molybdate-based reagents

    • Conduct time-course experiments at physiologically relevant temperatures

    • Include appropriate controls to account for non-enzymatic ATP hydrolysis

  • Coupled Enzyme Assays:

    • Link ATP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase

    • Monitor decrease in NADH absorbance at 340 nm in real-time

    • Calculate activity rates under varying substrate concentrations

Kinetic Analysis:

  • Determine Km and Vmax parameters through Michaelis-Menten kinetics

  • Assess the effects of pH, temperature, and divalent cations (Mg2+, Mn2+, Ca2+) on activity

  • Evaluate potential inhibitors to characterize the active site

When conducting these assays, it's critical to include appropriate controls, such as heat-inactivated enzyme and samples without ATP, to ensure accurate measurement of specific activity. Additionally, the preference order for nucleotides should be established, as research on related proteins has shown preferential binding of purine nucleotides over pyrimidine nucleotides .

What structural features are essential for AtpB function, and how can they be experimentally investigated?

Critical structural features of AtpB can be investigated through systematic mutational analysis and structural studies:

Key Structural Domains:

  • Transmembrane Helices: Essential for proton translocation and membrane integration

  • Conserved Motifs: Including motifs A, B, and C that are involved in nucleotide binding and hydrolysis

  • Interface Regions: Areas that interact with other ATP synthase subunits

Experimental Investigation Approaches:

  • Site-Directed Mutagenesis:

    • Target highly conserved residues in motifs A, B, and C

    • Focus on residues like G522, T529 in motif A; D566, E567 in motif B; and K600 in motif C, which have been shown to be critical in related proteins

    • Create two types of mutations:
      a) Substitutions with residues never found at corresponding positions in NTP-binding proteins
      b) Conservative substitutions with residues found in homologous proteins

  • Structural Analysis:

    • Apply AlphaFold or similar structure prediction tools to model the protein structure

    • Pay particular attention to residues like G108 that coordinate with other amino acids (e.g., V232) to maintain nucleotide binding regions

    • Use molecular dynamics simulations to predict the impact of mutations on structure and function

  • Functional Assessment of Mutants:

    • Compare ATP binding and hydrolysis activities of wild-type and mutant proteins

    • Assess the ability of mutants to complement defective ATP synthase in appropriate model systems

    • Evaluate the assembly of mutant proteins into the ATP synthase complex

Table 2: Critical Residues for Experimental Investigation in AtpB

MotifResidueSuggested MutationsExpected Effect
AG522G522IDisruption of ATP binding
AT529T529A, T529SAltered binding affinity
BD566D566LImpaired catalytic activity
BE567E567DModified hydrolysis rate
CK600K600QReduced nucleotide binding

These experimental approaches will provide insights into structure-function relationships of AtpB and may identify potential targets for therapeutic interventions against Anaplasma marginale infections.

How does Anaplasma marginale AtpB differ from homologs in other bacterial species?

Anaplasma marginale AtpB exhibits both conserved features and unique characteristics when compared to homologs in other bacterial species:

Sequence Conservation Analysis:
The atpB protein from Anaplasma marginale shares varying degrees of sequence identity with other bacterial species, particularly within the order Rickettsiales. Key observations include:

  • Highest sequence conservation occurs in the nucleotide-binding domains and proton channel-forming regions

  • The N-terminal region shows greater variability compared to the C-terminal domain

  • Specific amino acid residues like G108 are invariant across species, suggesting critical functional roles

Structural Differences:

  • Anaplasma marginale AtpB contains unique transmembrane topology patterns compared to model organisms like E. coli

  • The proton channel architecture shows adaptations potentially related to the pathogen's intracellular lifestyle

  • Specific insertions/deletions in loop regions may reflect adaptation to different membrane environments

Functional Implications:

  • Differences in ATP binding affinity and catalytic efficiency may influence energy metabolism

  • Unique structural features could affect interactions with inhibitors and provide targets for species-specific interventions

  • Variations in subunit interfaces might impact assembly of the complete ATP synthase complex

Understanding these differences is essential for developing targeted approaches against Anaplasma marginale while minimizing effects on beneficial bacteria or host ATP synthases.

What are the relationships between AtpB function and Anaplasma marginale pathogenesis?

The relationship between AtpB function and Anaplasma marginale pathogenesis is multifaceted:

Energy Metabolism and Pathogen Survival:
AtpB, as a component of ATP synthase, plays a crucial role in energy production for Anaplasma marginale. Unlike free-living bacteria, this intracellular pathogen has evolved specialized mechanisms to obtain energy within host cells:

  • Anaplasma marginale may modulate host cell energy metabolism, particularly the TCA cycle and oxidative phosphorylation, to favor its own survival

  • The pathogen potentially redirects host metabolic pathways to ensure sufficient ATP production for its replication

Host Cell Manipulation:

  • ATP generated through ATP synthase activity may power specialized secretion systems that deliver virulence factors

  • AtpB-dependent energy production supports the pathogen's ability to subvert host immune responses

  • The membrane potential maintained by ATP synthase activity influences nutrient acquisition from the host cell

Potential as Therapeutic Target:
The essential nature of ATP synthase makes AtpB an attractive target for therapeutic intervention:

  • Structural differences between pathogen and host ATP synthase may allow for selective targeting

  • Inhibition of AtpB function could disrupt the pathogen's energy metabolism, limiting its ability to replicate within host cells

  • The conservation of AtpB across Anaplasma strains suggests that effective inhibitors might have broad-spectrum activity

Experimental Evidence:
Studies on related pathogens indicate that disruption of normal ATP synthase function significantly impacts pathogen survival and virulence. In Anaplasma marginale specifically, the manipulation of host carbohydrate metabolism and TCA cycle inhibition suggests that energy production is a critical aspect of its pathogenic strategy .

How can recombinant AtpB be utilized in the development of novel diagnostics for anaplasmosis?

Recombinant Anaplasma marginale AtpB offers several promising avenues for developing improved diagnostic tools for anaplasmosis:

Serological Diagnostic Development:
Recombinant AtpB can serve as a highly specific antigen in ELISA, Western blot, and lateral flow assays for detecting anti-Anaplasma antibodies in host serum. The methodological approach should include:

  • Optimization of Antigen Presentation:

    • Evaluate different coating concentrations (typically 0.1-1.0 μg/well for ELISA)

    • Compare direct adsorption vs. capture antibody immobilization

    • Assess various blocking agents to minimize background

  • Assay Validation:

    • Determine sensitivity and specificity using panels of known positive and negative samples

    • Establish cut-off values through ROC curve analysis

    • Conduct cross-reactivity testing with related pathogens

Molecular Diagnostic Applications:

  • Competitive PCR Standards:

    • Develop quantitative PCR assays using recombinant AtpB-encoding plasmids as standards

    • Design primers targeting conserved regions of the atpB gene

  • Biosensor Development:

    • Immobilize recombinant AtpB on sensor surfaces for antibody detection

    • Utilize technologies like surface plasmon resonance or impedance spectroscopy for quantitative measurements

Table 3: Performance Comparison of Potential AtpB-Based Diagnostic Platforms

Diagnostic PlatformSensitivitySpecificitySample TypeTime-to-ResultField Applicability
AtpB ELISAHighHighSerum2-4 hoursLaboratory
AtpB Lateral FlowModerateHighWhole blood/serum15-30 minutesField-deployable
AtpB qPCRVery HighVery HighBlood/tissue1-2 hoursLaboratory
AtpB BiosensorHighHighSerum30-60 minutesPotentially field-deployable

The high purity (>90%) of recombinant AtpB protein preparations makes them particularly suitable for diagnostic applications where specificity is paramount . When developing these diagnostics, it is essential to validate them against current gold standard methods and ensure they perform consistently across different host species and Anaplasma strains.

What approaches can be used to study the role of AtpB in drug resistance mechanisms?

Investigating AtpB's involvement in drug resistance requires systematic approaches:

Comparative Analysis of Resistant Strains:

  • Sequence Analysis:

    • Compare atpB gene sequences from drug-sensitive and resistant isolates

    • Identify single nucleotide polymorphisms or mutations in resistant strains

    • Correlate genetic changes with resistance phenotypes

  • Expression Level Studies:

    • Quantify AtpB expression in resistant vs. sensitive strains using qRT-PCR

    • Perform Western blot analysis with specific antibodies against AtpB

    • Determine if overexpression contributes to resistance mechanisms

Functional Studies with Recombinant Protein:

  • Drug Binding Assays:

    • Evaluate direct binding of antimicrobial compounds to wild-type and mutant AtpB

    • Use techniques like isothermal titration calorimetry or surface plasmon resonance

    • Determine binding constants and thermodynamic parameters

  • Site-Directed Mutagenesis:

    • Create recombinant AtpB variants with mutations observed in resistant clinical isolates

    • Assess impact on ATP binding, hydrolysis, and drug interaction

    • Perform complementation studies in model systems

Structural Approaches:

  • In silico Modeling:

    • Generate structural models of wild-type and mutant AtpB proteins

    • Perform molecular docking studies with potential inhibitors

    • Identify binding pockets and critical interaction residues

  • Drug Resistance Mechanism Characterization:

    • Determine if resistance occurs through altered drug binding, enhanced efflux, or metabolic adaptation

    • Study the impact of ATP synthase inhibitors on membrane potential and proton motive force

    • Evaluate potential for cross-resistance to different drug classes

Through these methodological approaches, researchers can gain insights into the role of AtpB in drug resistance and potentially develop strategies to overcome resistance mechanisms in Anaplasma marginale infections.

Can nuclear-encoded AtpB complement chloroplast atpB mutations in plant systems?

Recent research on the functional relocation of the atpB gene from chloroplast to nuclear genomes provides valuable insights for researchers considering similar approaches with bacterial atpB genes:

Evidence from Plant Systems:
Studies with maize have demonstrated that nuclear-encoded, chloroplast-targeted AtpB can functionally complement chloroplast atpB mutations. Key findings include:

  • Complementation Efficiency:

    • Nuclear-expressed AtpB restored chlorophyll accumulation and supported wild-type growth in tissue culture

    • Nonphotochemical quenching (NPQ) function was fully restored

    • Maximum quantum yield of photosystem II (Fv/Fm) reached approximately 30% of wild-type levels

  • Protein Accumulation Levels:

    • Nuclear-encoded AtpB accumulated at only ~5% of native chloroplast-encoded protein levels

    • Despite lower accumulation, this was sufficient to enable photosynthesis in complemented lines

Methodological Considerations for Similar Approaches:

  • Transit Peptide Selection:

    • Appropriate signal sequences are critical for targeting recombinant AtpB to the correct cellular compartment

    • The RbcS2 chloroplast transit peptide has proven effective in plant systems

  • Codon Optimization:

    • For nuclear expression of bacterial genes, codon optimization is essential

    • Optimization should account for the codon bias of the target expression system

  • Epitope Tagging:

    • C-terminal epitope tags (like HA) can be added without disrupting protein function

    • This facilitates distinction between native and recombinant proteins

These findings suggest that similar approaches could potentially be applied to bacterial systems, providing a framework for investigating AtpB function through complementation studies. The observation that even low levels of recombinant AtpB (~5%) can restore function is particularly significant, indicating that complete replacement of native protein is not necessary for functional studies .

What methodological approaches enable the study of AtpB mutations on ATP synthase function?

Studying the impact of AtpB mutations on ATP synthase function requires methodical approaches:

Generation of AtpB Variants:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues in motifs A, B, and C

    • Create two types of mutations:
      a) Substitutions with residues never found at corresponding positions (e.g., G522I, T529A, D566L, K600Q)
      b) Conservative substitutions with residues found in homologous proteins (e.g., T529S, E567D)

    • Use overlap extension PCR or whole-plasmid PCR approaches for mutagenesis

  • Expression System Selection:

    • E. coli expression systems are suitable for initial characterization

    • Consider homologous expression in Anaplasma-related systems for more native-like conditions

Functional Characterization Methods:

  • ATP Binding Assessment:

    • UV cross-linking with [α-32P]ATP to quantify binding capacity

    • Competition assays with unlabeled nucleotides to determine binding specificity

    • Analyze binding data for wild-type and mutant proteins using Scatchard plot analysis

  • ATPase Activity Analysis:

    • Measure rates of ATP hydrolysis using phosphate release assays

    • Determine enzyme kinetics parameters (Km, Vmax) for each variant

    • Assess the effects of pH, temperature, and divalent cations on enzyme activity

  • Structural Impact Evaluation:

    • Use circular dichroism spectroscopy to assess secondary structure changes

    • Apply differential scanning calorimetry to evaluate thermal stability

    • Consider limited proteolysis to identify conformational changes

Complementation Approaches:

  • In vitro Reconstitution:

    • Incorporate purified wild-type or mutant AtpB into liposomes

    • Measure ATP synthesis or proton pumping activity

    • Quantify the impact of mutations on energy coupling efficiency

  • In vivo Complementation:

    • Develop systems where endogenous atpB is inactivated and complemented with recombinant variants

    • Assess growth rates, ATP production, and other phenotypic characteristics

    • Evaluate competitive fitness of strains expressing different AtpB variants

These methodological approaches provide a comprehensive framework for investigating the structure-function relationships of AtpB and can help identify critical residues for potential therapeutic targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.