Recombinant Anaplasma phagocytophilum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Role in Bacterial Physiology

ATP synthase subunit a is essential for coupling proton flux to ATP production. In Anaplasma species:

Species-Specific Challenges

  • A. phagocytophilum lacks ATP/ADP translocase, limiting its ability to import host ATP . This suggests ATP synthase may serve specialized roles, such as pH homeostasis or nutrient acquisition.

  • Antigenic Potential: ATP synthase subunits in other pathogens (e.g., Mycobacterium tuberculosis) are vaccine targets. A. phagocytophilum subunit a could similarly modulate host immune responses.

Experimental Approaches for Further Study

To elucidate subunit a’s role in A. phagocytophilum:

  1. Protein Expression: Recombinant expression using E. coli (as in A. marginale) followed by crystallization for structural analysis.

  2. Functional Assays:

    • Proton Transport: Measure proton flux in liposomal systems using purified subunit a.

    • Host Interaction: Investigate binding to host mitochondria or membrane proteins (e.g., CD13, as seen with other invasins ).

  3. Antibody Blocking: Neutralize subunit a with domain-specific antibodies to assess infection rates in cell cultures.

Comparative Analysis with Other Anaplasma Proteins

ProteinFunctionRelevance to ATP Synthase
OmpAReceptor binding (sLe⁺x)Potential co-option for ATP synthase localization
Asp14Host cell invasionMay interact with subunit a indirectly via membrane dynamics
MSP4/HSP70Stress response, membrane stabilityLinks to energy metabolism under stress

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpB; APH_1192; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Anaplasma phagocytophilum (strain HZ)
Target Names
atpB
Target Protein Sequence
MSPLEQFKVVRLLEIPMPFGMDISFTNCALFMILASLVSAVLLCCALRKRTDGSSSMSHT AVELIYNFVVGAIESNAGVGGLRYIPFVLSIFLFVLACNIIGILPLGFTATSHVSVTLAL SVVVCASVTVLGFNHQGLHFLRIFLPEGTPLWLAPMMVFIKLFAYLARPVSLAIRLAANM IAGHTIIAVIAEFVLKMHPVLAPLPFAFIMVLIAFEIFVAILQAYIFTVLTTVYLSDAVA GH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaplasma phagocytophilum and why is its ATP synthase important?

Anaplasma phagocytophilum (Ap) is an obligate intracellular, tick-borne bacterium that causes granulocytic anaplasmosis in humans, dogs, sheep, and horses. In mammals, neutrophil granulocytes are a primary target of infection, while in ticks, Ap has been found in gut and salivary gland cells . As an obligate intracellular pathogen, Ap must efficiently utilize energy resources to survive both inside host cells and during transmission between hosts. ATP synthase is crucial because it generates ATP, the primary energy currency of the cell, through oxidative phosphorylation. The ATP synthase complex consists of two functional domains: F₁, situated in the matrix or cytoplasm, and F₀, located in the membrane . ATP synthase subunit a (atpB) is a critical component of the F₀ domain and plays an essential role in proton translocation across the membrane, which drives ATP synthesis.

How does ATP synthase function in bacterial pathogens like A. phagocytophilum?

In bacterial pathogens including A. phagocytophilum, ATP synthase functions as a rotary nanomotor that couples the electrochemical proton gradient to ATP synthesis. The F₀ portion, which includes subunit a (atpB), forms a proton channel in the membrane through which protons flow down their electrochemical gradient from the periplasm (or intermembrane space) into the cytoplasm . This proton flow drives the rotation of the c-ring in F₀, which is connected to the γ, δ, and ε subunits of F₁. As these components rotate within the F₁ α₃β₃ hexamer, conformational changes occur in the catalytic sites located at the interfaces of α and β subunits, enabling the synthesis of ATP from ADP and inorganic phosphate (Pi) . This "rotary catalysis" mechanism follows the "binding-change" principle, where each catalytic site cycles through different conformational states as the γ subunit rotates, ultimately resulting in ATP formation and release .

What evidence supports the importance of ATP synthase for A. phagocytophilum survival?

Several lines of evidence demonstrate the importance of ATP synthase for A. phagocytophilum survival. Transcriptomic studies have shown differential expression of ATP synthase subunits under various conditions, indicating careful regulation of this critical complex. For instance, research has identified antisense transcripts at the junction of HGE1_05172 (putative ATP synthase F₀, B subunit) and HGE1_05177 (ATP synthase subunit C), suggesting complex regulation of ATP synthase expression . Additionally, studies of the related rickettsial pathogen Ehrlichia have shown that freshly isolated bacteria can transiently produce ATP, which is essential for their extracellular resistance and survival . The correlation between ATP levels and bacterial viability strongly suggests that ATP synthase function is critical for pathogen survival, particularly during the challenging extracellular phase of the infection cycle.

How is the structure of A. phagocytophilum ATP synthase subunit a (atpB) different from other bacterial homologs?

The A. phagocytophilum ATP synthase subunit a (atpB) shares the core structural features of other bacterial homologs but contains unique adaptations reflective of its specialized intracellular lifestyle. The protein contains transmembrane helices that form part of the proton channel in the F₀ domain of ATP synthase. A key structural feature is the presence of conserved charged residues that are essential for proton translocation. While the exact three-dimensional structure of A. phagocytophilum atpB has not been fully determined, comparative genomics and transcriptional analyses indicate potential unique features. Transcriptomic data shows that atpB expression is carefully regulated, with evidence of antisense transcripts that may modulate its expression . These regulatory mechanisms might represent adaptations to the obligate intracellular lifestyle of A. phagocytophilum, allowing precise control of energy production in response to changing host environments.

What factors influence the expression of ATP synthase genes in A. phagocytophilum?

ATP synthase gene expression in A. phagocytophilum is influenced by multiple factors, including the host cell type and infection stage. Transcriptomic analyses have revealed differential expression patterns between bacteria in human cells (HL-60) versus tick cells (ISE6) . When A. phagocytophilum transitions between these different host environments, it adjusts the expression of various genes, including those encoding ATP synthase components. Specifically, antisense transcripts have been detected at the junction of ATP synthase subunit genes, which may play a role in post-transcriptional regulation . This suggests sophisticated regulatory mechanisms that allow the pathogen to adapt its energy metabolism to different host environments. The presence of these antisense transcripts indicates that non-coding RNAs might be important regulators of ATP synthase expression, representing an additional layer of control beyond transcriptional regulation.

What are the optimal conditions for expressing recombinant A. phagocytophilum atpB protein?

The optimal expression of recombinant A. phagocytophilum atpB requires careful consideration of several factors. For bacterial expression systems, E. coli BL21(DE3) or Rosetta strains are recommended due to their reduced protease activity and ability to express genes with rare codons that might be present in A. phagocytophilum. Expression should be conducted at lower temperatures (16-25°C) to enhance proper protein folding and solubility, as membrane proteins like atpB often form inclusion bodies at higher temperatures. Induction with lower IPTG concentrations (0.1-0.5 mM) for longer periods (16-24 hours) typically yields better results than strong induction conditions. For membrane proteins like atpB, adding mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin during cell lysis helps solubilize the protein. Additionally, fusion tags such as His6, MBP, or SUMO can improve solubility and facilitate purification. Testing multiple constructs with different tag positions (N- or C-terminal) is advisable, as the optimal configuration depends on the specific protein's structure.

What purification strategies yield the highest purity and activity of recombinant atpB?

Purifying recombinant atpB to high purity while maintaining its activity requires a multi-step approach. Initially, affinity chromatography using the fusion tag (typically His6-tag) provides the first purification step. For membrane proteins like atpB, all buffers should contain appropriate detergents at concentrations above their critical micelle concentration to maintain protein solubility. Following affinity purification, size exclusion chromatography is effective for removing aggregates and obtaining homogeneous protein preparations. For functional studies, it's crucial to reconstitute the purified atpB into liposomes or nanodiscs to provide a membrane-like environment. This can be achieved through detergent dialysis or direct incorporation methods using phospholipids that mimic the bacterial membrane composition. Activity assays should measure proton translocation capability rather than ATP synthesis directly, as atpB is only one component of the ATP synthase complex. Fluorescent pH indicators or potentiometric dyes can be used to assess proton translocation activity in reconstituted systems.

How can researchers verify the functional activity of recombinant atpB?

Verifying the functional activity of recombinant atpB presents challenges since it is only one component of the multi-subunit ATP synthase complex. Several complementary approaches are recommended. First, structural integrity can be assessed through circular dichroism spectroscopy to confirm proper secondary structure formation, particularly the alpha-helical content expected in membrane proteins like atpB. Second, proton translocation activity can be measured in reconstituted proteoliposomes using pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine. Third, researchers can perform complementation studies in bacterial strains with atpB deletions or mutations to determine if the recombinant protein restores ATP synthesis capability. This approach has been successful with other ATP synthase components, as demonstrated in studies with RipE protein in Ehrlichia, where genomic complementation restored ATP levels in mutant strains . Finally, binding assays with other ATP synthase subunits can confirm proper protein-protein interactions, which are essential for function within the complete ATP synthase complex.

How does atpB contribute to A. phagocytophilum's adaptation to different host environments?

ATP synthase subunit a (atpB) plays a crucial role in A. phagocytophilum's adaptation to different host environments through its contribution to energy metabolism regulation. Transcriptomic analyses have revealed differential expression patterns of ATP synthase components, including atpB, between bacteria in human cells (HL-60) versus tick cells (ISE6) . This differential expression likely reflects the pathogen's adaptation to the distinct metabolic landscapes of mammalian and arthropod hosts. The energy requirements and available resources differ significantly between these environments, necessitating adjustments in ATP production machinery. Additionally, antisense transcripts detected at ATP synthase gene junctions suggest sophisticated post-transcriptional regulation mechanisms that may enable rapid adaptation to changing conditions . This regulatory flexibility likely contributes to the bacterium's ability to transition successfully between warm-blooded hosts and cold-blooded ticks, environments that present dramatically different metabolic challenges.

What is the relationship between ATP synthase activity and virulence in A. phagocytophilum?

ATP synthase activity appears to be intricately linked to A. phagocytophilum virulence through several mechanisms. Energy production is essential for key virulence processes, including invasion, intracellular replication, and evasion of host immune responses. Research on the related bacterium A. phagocytophilum has demonstrated that a T4SS effector protein, Ats-1, targets host cell mitochondria and upregulates energy production by enhancing the expression of respiratory chain components . This manipulation of host energy metabolism ultimately facilitates bacterial replication. The table below summarizes the relationship between ATP-related factors and virulence mechanisms in Anaplasmataceae:

FactorFunctionEffect on VirulenceReference
ATP synthaseEnergy productionSupports bacterial replication and survival
Ats-1 (effector protein)Targets host mitochondriaEnhances energy production, inhibits apoptosis
RipE (in related Ehrlichia)Maintains higher ATP levelsIncreases extracellular resistance
Host respiratory chain proteins (NDUFB3, NDUFB5, etc.)Upregulated by bacterial factorsProvides energy for bacterial replication

The relationship between ATP levels and bacterial survival is particularly evident during the extracellular phase. Studies with Ehrlichia have shown that higher ATP levels correlate with improved extracellular resistance, a critical factor for successful transmission between hosts .

How can multi-omics approaches be used to study the role of atpB in A. phagocytophilum pathogenesis?

Multi-omics approaches offer powerful tools for investigating the role of atpB in A. phagocytophilum pathogenesis. These integrative strategies can reveal connections between gene expression, protein function, and metabolic outcomes. A comprehensive multi-omics approach should include:

  • Genomics: Comparative genomic analyses can identify atpB sequence variations across A. phagocytophilum strains with different virulence profiles, potentially linking specific sequence features to pathogenicity.

  • Transcriptomics: RNA-seq and tiling microarrays can map the transcriptional landscape of atpB under various conditions, including different host cell types and infection stages . Special attention should be paid to antisense transcripts that may regulate atpB expression.

  • Proteomics: Quantitative proteomics techniques like iTRAQ (Isobaric Tags for Relative and Absolute Quantitation) and PRM (Parallel Reaction Monitoring) can measure atpB protein levels and post-translational modifications . Protein interaction studies can identify binding partners within the ATP synthase complex and potentially novel interactions.

  • Metabolomics: Targeted metabolomics focusing on ATP/ADP ratios and related metabolites can directly assess the functional impact of atpB on energy metabolism . Isotope labeling approaches can track the flow of metabolites through pathways dependent on ATP synthase activity.

  • Integration: Computational approaches should be employed to integrate these multi-omics datasets, identifying correlations between atpB expression, ATP synthase activity, and virulence-related phenotypes.

This multi-omics framework has proven effective in related studies, such as the investigation of Ats-1's role in regulating mitochondrial respiration in host cells . Similar approaches would provide a comprehensive understanding of atpB's contribution to A. phagocytophilum pathogenesis.

What gene complementation strategies are effective for studying atpB function?

Effective gene complementation strategies for studying atpB function in A. phagocytophilum require careful consideration of expression control and genetic stability. Based on successful approaches with related rickettsial pathogens, several complementation strategies can be recommended. First, genomic complementation using Himar1 transposon mutagenesis has proven effective in Ehrlichia studies, where the reintroduction of genes like ripE restored phenotypes in deletion mutants . This approach allows for stable chromosomal integration and potentially native-like expression levels. Second, plasmid-based complementation systems with inducible promoters offer greater control over expression timing and levels, though maintaining plasmid stability in obligate intracellular bacteria presents challenges. Third, complementation can be performed using fusion proteins with epitope tags (such as FLAG) to facilitate detection and purification, as demonstrated in the RipE complementation studies . The choice between these approaches depends on the specific research question, with genomic complementation providing more physiologically relevant conditions, while plasmid-based systems offer greater experimental flexibility.

How can CRISPR-Cas9 approaches be adapted for atpB functional studies in A. phagocytophilum?

Adapting CRISPR-Cas9 approaches for atpB functional studies in A. phagocytophilum presents unique challenges due to the bacterium's obligate intracellular lifestyle but offers powerful capabilities for precise genetic manipulation. A feasible CRISPR-Cas9 strategy would involve:

  • Delivery method optimization: Electroporation of CRISPR-Cas9 components into purified, host-free A. phagocytophilum, followed by immediate infection of host cells to allow bacterial recovery.

  • Guide RNA design: Careful sgRNA design targeting atpB with minimized off-target effects, potentially using A. phagocytophilum codon-optimized versions.

  • Modifications rather than deletions: Since complete deletion of atpB might be lethal, creating point mutations or domain-specific modifications that alter function without eliminating it completely.

  • Repair template design: Homology-directed repair templates containing the desired modifications along with selection markers or reporter genes to facilitate identification of successfully edited bacteria.

  • Conditional approaches: Implementation of conditional systems where atpB expression can be regulated post-editing, such as tetracycline-responsive elements or destabilization domains.

  • Screening strategy: Development of efficient screening methods, potentially using energy metabolism phenotypes, growth rates, or ATP level measurements to identify successfully edited clones.

This approach would allow for precise modification of atpB to study specific structural features and their functional significance without completely eliminating this potentially essential gene.

What phenotypic assays best measure the impact of atpB mutations on A. phagocytophilum fitness?

Multiple phenotypic assays can effectively measure the impact of atpB mutations on A. phagocytophilum fitness, capturing various aspects of the bacterium's life cycle and energy metabolism. The most informative assays include:

  • ATP quantification assays: Direct measurement of ATP levels in purified bacteria using luminescent ATP detection assays, as demonstrated in studies with Ehrlichia . This provides a direct assessment of energy production capacity.

  • Extracellular survival assays: Measuring bacterial viability during the extracellular phase through methods such as live/dead staining or reinfection capability after defined periods outside host cells . ATP synthase function is particularly critical during this vulnerable stage.

  • Growth kinetics: Monitoring bacterial replication rates within host cells through qPCR quantification of bacterial DNA or immunofluorescence microscopy with automated image analysis .

  • Host cell type adaptation: Comparing growth in different host cell types (e.g., human HL-60 versus tick ISE6 cells) to assess the impact of atpB mutations on adaptation to different environments .

  • Transcriptional response analysis: RNA-seq or targeted qRT-PCR to measure compensatory changes in expression of other ATP synthase components or energy metabolism genes in response to atpB mutations.

  • Transmission electron microscopy: Evaluating bacterial ultrastructure to detect morphological abnormalities that might result from energy metabolism defects.

These complementary approaches provide a comprehensive assessment of how atpB mutations affect A. phagocytophilum's energy production, growth, and adaptive capabilities across different phases of its infectious cycle.

How might targeting atpB function lead to novel therapeutic approaches for anaplasmosis?

Targeting atpB function represents a promising avenue for developing novel therapeutics against anaplasmosis, based on several key characteristics of this protein. As a component of ATP synthase, atpB is essential for energy production, particularly during the critical extracellular phase of A. phagocytophilum's life cycle . This dependency creates a vulnerability that could be exploited therapeutically. Small molecule inhibitors specifically designed to block the proton channel function of atpB could disrupt ATP production, compromising bacterial survival during transmission between cells. The structural differences between bacterial and mammalian ATP synthase components provide opportunities for selective targeting, potentially minimizing host toxicity. Additionally, antibodies or peptide-based therapeutics targeting exposed portions of atpB could interfere with ATP synthase assembly or function. Combination approaches that simultaneously target atpB and other critical components of bacterial energy metabolism might increase efficacy and reduce the likelihood of resistance development. The potential therapeutic value is enhanced by the fact that energy metabolism is particularly crucial during the extracellular phase, providing a window of vulnerability during which the pathogen might be more susceptible to ATP synthase inhibitors.

What are the current limitations in studying A. phagocytophilum atpB and how might they be overcome?

Current limitations in studying A. phagocytophilum atpB stem from multiple technical challenges inherent to this obligate intracellular pathogen. The primary limitations and potential solutions include:

  • Cultivation challenges: A. phagocytophilum requires host cells for propagation, complicating the isolation of sufficient bacterial material for biochemical studies. Advanced cell culture systems, including bioreactors and optimized infection protocols, can increase yields. Additionally, heterologous expression in surrogate bacterial systems might provide alternatives for protein production.

  • Genetic manipulation difficulties: The obligate intracellular lifestyle makes traditional genetic approaches challenging. Adaptation of methods successful in related rickettsial pathogens, such as Himar1 transposon mutagenesis demonstrated with Ehrlichia , offers promising alternatives. Additionally, cell-free genome editing followed by reintroduction into host cells represents an emerging approach.

  • Membrane protein complexity: As a membrane protein, atpB presents challenges for structural and functional studies. Advanced membrane protein purification techniques, including native nanodiscs and styrene maleic acid lipid particles (SMALPs), can help maintain native-like environments during purification.

  • Limited structural information: The lack of crystal or cryo-EM structures for A. phagocytophilum ATP synthase components hinders structure-based studies. Computational approaches like AlphaFold2 can provide preliminary structural models while efforts continue toward experimental structure determination.

  • Complex regulation: The presence of antisense transcripts and potential post-transcriptional regulation adds complexity to understanding atpB expression. Single-cell approaches and advanced RNA-seq methods can help decipher these regulatory mechanisms.

Addressing these limitations through innovative methodological approaches will significantly advance our understanding of atpB's role in A. phagocytophilum pathogenesis.

What emerging technologies might transform our understanding of ATP synthase function in intracellular pathogens?

Several emerging technologies hold promise for transforming our understanding of ATP synthase function in intracellular pathogens like A. phagocytophilum:

These technologies, especially when used in combination, promise to overcome current limitations and provide new insights into how intracellular pathogens like A. phagocytophilum optimize their energy metabolism across diverse host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.