Recombinant Anaplasma phagocytophilum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Pathogen Characteristics and Clinical Significance

Anaplasma phagocytophilum is an obligatory intracellular bacterium belonging to the order Rickettsiales that primarily infects granulocytes in various mammals . As the etiologic agent of human granulocytic anaplasmosis (HGA), this pathogen represents a significant public health concern with increasing incidence rates in tick-endemic regions. The bacterium is transmitted primarily through the bite of infected Ixodes scapularis ticks, establishing complex interactions with both the arthropod vector and vertebrate host cells . Understanding the molecular mechanisms that facilitate A. phagocytophilum's intracellular lifestyle is essential for developing effective intervention strategies against this emerging infectious disease.

Molecular Pathogenesis and Infection Mechanisms

A. phagocytophilum employs sophisticated molecular machinery to invade host cells, evade immune responses, and establish persistent infections. The pathogen alters neutrophil function through various secreted effector proteins and metabolic manipulations . Previous studies have characterized several key proteins involved in A. phagocytophilum pathogenesis, including the major surface protein 5 (Msp5) and the two-component PleC-PleD regulatory system . These bacterial factors play critical roles in the infection cycle, with recent evidence suggesting that the PleC-PleD system functions as a diguanylate cyclase that regulates A. phagocytophilum intracellular infection through cyclic di-GMP signaling .

Host-Pathogen Interactions at the Metabolic Level

A systems biology approach integrating metabolomics, transcriptomics, and proteomics has revealed that A. phagocytophilum infection significantly affects host cell metabolic pathways, particularly protein processing in the endoplasmic reticulum and glucose metabolism . These metabolic alterations likely represent coevolved mechanisms that facilitate pathogen survival within the hostile intracellular environment. Understanding the specific enzymes involved in these metabolic interactions provides valuable insights into the fundamental biology of this host-pathogen relationship.

Genomic Organization and Conservation

The plsY gene is generally well-conserved across bacterial species, highlighting its essential role in cellular metabolism. Similar to other A. phagocytophilum proteins like Msp5, which shows high conservation among geographical isolates, the plsY enzyme likely maintains substantial sequence homology across different strains . Comparative genomic analyses of A. phagocytophilum isolates from different geographic locations and host species have revealed varying degrees of conservation for different genes, suggesting potential adaptive evolution in response to distinct ecological niches and host environments.

Metabolic Significance in Bacterial Physiology

As a key enzyme in phospholipid biosynthesis, plsY plays a crucial role in bacterial membrane formation and integrity. For obligate intracellular pathogens like A. phagocytophilum, proper membrane biogenesis is essential not only for basic cellular functions but also for establishing and maintaining the specialized membrane-bound compartments in which these bacteria reside within host cells. The enzyme's activity directly impacts the composition and properties of bacterial membranes, potentially influencing pathogen survival, replication, and host-cell interactions.

Expression Systems and Methodologies

Recombinant production of A. phagocytophilum proteins typically employs prokaryotic expression systems, with Escherichia coli serving as the predominant host organism. Based on established protocols for other A. phagocytophilum proteins, recombinant plsY would likely be expressed using vectors containing inducible promoters and appropriate fusion tags to facilitate purification and detection . The expression process typically involves transformation of E. coli cells with the recombinant plasmid, followed by induction of protein expression, cell lysis, and protein purification using affinity chromatography methods.

Protein Purification Strategies

Purification of recombinant A. phagocytophilum plsY would likely employ affinity chromatography approaches similar to those used for other bacterial membrane proteins. Based on comparable recombinant protein systems, the enzyme may be expressed with an N-terminal or C-terminal histidine tag, allowing for purification using immobilized metal affinity chromatography (IMAC) . For membrane-associated proteins like plsY, additional considerations regarding protein solubility and proper folding are essential, potentially requiring the use of detergents or lipid reconstitution to maintain enzymatic activity.

Functional Characterization Methods

Enzymatic activity of recombinant plsY can be assessed through various biochemical assays measuring the transfer of acyl groups to glycerol-3-phosphate. These functional studies are critical for confirming that the recombinant protein maintains its native enzymatic properties. Additional structural analyses using techniques such as X-ray crystallography or cryo-electron microscopy could provide valuable insights into the protein's three-dimensional structure and mechanism of action, though such studies remain to be conducted for A. phagocytophilum plsY.

Diagnostic Applications

Recombinant A. phagocytophilum proteins have demonstrated significant utility in diagnostic applications. For instance, recombinant Msp5 has been used in enzyme-linked immunosorbent assays (ELISAs) for serological detection of A. phagocytophilum infections . The following table summarizes potential diagnostic applications for recombinant A. phagocytophilum plsY:

Diagnostic MethodPrinciplePotential AdvantagesChallenges
Indirect ELISADetection of anti-plsY antibodies in patient seraPotentially high sensitivityCross-reactivity with related species
Western BlotConfirmation of serological resultsHigher specificity than ELISAMore labor-intensive than ELISA
Protein MicroarrayMultiplex detection of antibodies against various A. phagocytophilum proteinsComprehensive immune response profilingRequires specialized equipment
PCR-based detectionAmplification of plsY gene sequencesDirect pathogen detectionMay require high bacterial loads

Therapeutic Target Potential

As an essential enzyme in bacterial metabolism, plsY represents a potential therapeutic target for developing novel antimicrobial agents against A. phagocytophilum. Inhibition of plsY activity could disrupt bacterial phospholipid biosynthesis, potentially compromising membrane integrity and bacterial viability. Previous studies with other A. phagocytophilum proteins have demonstrated the potential of targeted inhibitors; for example, a cyclic di-GMP derivative has been shown to inhibit A. phagocytophilum infection in cell culture models . Similar approaches targeting plsY could yield promising candidates for anti-Anaplasma therapeutics.

Vaccine Development Considerations

Recombinant bacterial proteins often serve as candidates for subunit vaccine development. The potential of A. phagocytophilum plsY as a vaccine antigen would depend on factors such as its immunogenicity, conservation across strains, and accessibility to the immune system during infection. While membrane-associated proteins like plsY may present challenges for antibody recognition due to their embedded location in the bacterial membrane, enzymatic domains exposed to the periplasm or extracellular environment could potentially serve as antigenic determinants for protective immune responses.

Technical Challenges in Recombinant Protein Production

The production of functional recombinant membrane proteins like plsY presents several technical challenges, including issues related to protein solubility, proper folding, and maintenance of enzymatic activity. Optimization of expression conditions, selection of appropriate fusion tags, and development of effective purification strategies are critical considerations for obtaining high-quality recombinant protein for structural and functional studies. Alternative expression systems, such as cell-free protein synthesis or expression in eukaryotic cells, may offer advantages for challenging membrane proteins.

Knowledge Gaps in A. phagocytophilum Lipid Metabolism

Despite advances in understanding A. phagocytophilum biology, significant knowledge gaps remain regarding the specific roles of lipid metabolism enzymes like plsY in pathogen survival and virulence. Integration of metabolomics approaches with functional genomics could provide valuable insights into how these metabolic pathways contribute to the intracellular lifestyle of A. phagocytophilum . Comparative analyses of lipid metabolism across different Anaplasmataceae family members could further elucidate the evolutionary significance of these pathways in host adaptation and pathogenesis.

Future Research Priorities

Priority areas for future research on A. phagocytophilum plsY include:

  1. Cloning and expression of the plsY gene from clinically relevant A. phagocytophilum isolates

  2. Structural determination of the enzyme using crystallography or cryo-EM techniques

  3. Development of high-throughput screening assays for identifying potential plsY inhibitors

  4. In vivo studies evaluating the essentiality of plsY for A. phagocytophilum infection

  5. Assessment of plsY conservation across different A. phagocytophilum strains and related Anaplasma species

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
plsY; APH_0017; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-192
Protein Length
full length protein
Species
Anaplasma phagocytophilum (strain HZ)
Target Names
plsY
Target Protein Sequence
MFIAILMGAYLLGSIPFAYILTKLMAKRDIREVGSKNVGATNVFRVNKGLAGLVLLLDIA KSAVLIYSLKEYDIVSTKEELCIVGLLSVLGHIYPIWLKFKGGKGVATGIGVIIPLNPLM LCVFFISWLFTFNNTRYASLSSIVSIIATMIVCYLTESGVVALLYTVQSILILFKHRENI VRLIKREEKKVI
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaplasma phagocytophilum and why study its plsY protein?

Anaplasma phagocytophilum is an intracellular rickettsia-like bacterium that preferentially infects granulocytes and forms inclusion bodies called morulae. It is transmitted by Ixodes species ticks, which also transmit Borrelia burgdorferi and Babesia species. This pathogen causes human granulocytic anaplasmosis (HGA), a disease characterized by fever, myalgia, arthralgia, and nausea . The glycerol-3-phosphate acyltransferase (plsY) of A. phagocytophilum is critical for bacterial membrane phospholipid biosynthesis, making it an important target for understanding pathogen survival and potentially developing novel therapeutic strategies. As an integral membrane protein involved in the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, plsY represents a crucial component of bacterial physiology .

How does glycerol-3-phosphate acyltransferase (plsY) function in bacterial membrane biosynthesis?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a fundamental role in bacterial phospholipid biosynthesis. It catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate, which is a critical step in the formation of phosphatidic acid, the precursor to membrane phospholipids . In the most widely distributed bacterial pathway, acyl-acyl carrier protein is first converted to acylphosphate by PlsX, and then the acyl group is transferred from acylphosphate to glycerol 3-phosphate by PlsY . This enzymatic activity is essential for maintaining bacterial membrane integrity and function. The activity of plsY can be non-competitively inhibited by palmitoyl-CoA, suggesting potential regulatory mechanisms and therapeutic targets .

What is the membrane topology and structure of bacterial plsY?

The membrane topology of plsY has been characterized using the substituted cysteine accessibility method. Studies on Streptococcus pneumoniae PlsY reveal that the protein has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The protein contains three larger cytoplasmic domains, each hosting a highly conserved sequence motif that is critical for catalytic activity. Through site-directed mutagenesis studies, researchers have identified that Motif 1 contains essential serine and arginine residues. Motif 2 exhibits characteristics of a phosphate-binding loop and corresponds to the glycerol 3-phosphate binding site, as demonstrated by mutations of conserved glycines to alanines resulting in defective glycerol 3-phosphate binding. Motif 3 contains conserved histidine and asparagine residues important for activity, as well as a glutamate critical for the structural integrity of PlsY .

What expression systems are recommended for producing recombinant A. phagocytophilum plsY?

When designing expression systems for recombinant A. phagocytophilum plsY, researchers should consider several factors due to the protein's integral membrane nature. For successful expression, E. coli-based systems with specialized vectors designed for membrane proteins are recommended. Fusion tags such as His6, SUMO, or MBP can enhance solubility and facilitate purification. Temperature optimization is critical—lower temperatures (16-25°C) often improve proper folding of membrane proteins.

For difficult-to-express membrane proteins like plsY, consider these methodological approaches:

  • Use E. coli strains specifically engineered for membrane protein expression (C41(DE3), C43(DE3))

  • Employ detergent screening to identify optimal solubilization conditions

  • Consider cell-free expression systems if conventional methods yield poor results

When designing your experimental controls, include:

  • Empty vector controls

  • Expression of a well-characterized membrane protein as a positive control

  • Western blot analysis to confirm expression and size

  • Activity assays to verify functional folding

How can the enzymatic activity of recombinant plsY be accurately measured?

Measuring the enzymatic activity of recombinant plsY requires careful experimental design focusing on its ability to transfer acyl groups from acylphosphate to glycerol 3-phosphate. A comprehensive activity assay should include:

  • Substrate preparation: Synthesize or obtain purified acylphosphate and radiolabeled or fluorescently-tagged glycerol 3-phosphate

  • Reaction conditions optimization: Test various buffer compositions, pH values (typically 6.5-8.0), salt concentrations, and temperatures

  • Detection methods: Monitor product formation using:

    • Radiolabeled substrate tracking

    • HPLC separation of reaction products

    • Mass spectrometry for precise identification

When analyzing activity data, calculate kinetic parameters including Km for both substrates and Vmax values. For inhibition studies, palmitoyl-CoA can serve as a reference inhibitor since it has been shown to non-competitively inhibit plsY .

The experimental design should include proper controls:

  • Heat-inactivated enzyme control

  • No-substrate controls

  • Wildtype enzyme vs. site-directed mutants with altered conserved motifs

What site-directed mutagenesis strategies are most effective for studying plsY functional domains?

Site-directed mutagenesis represents a powerful approach for interrogating the structure-function relationships of plsY's conserved motifs. Based on previous research on bacterial acyltransferases, an effective mutagenesis strategy should target:

  • Conserved motifs identified through sequence alignment:

    • Motif 1: Focus on serine and arginine residues shown to be essential for catalysis

    • Motif 2: Target the phosphate-binding loop, particularly the conserved glycines that affect glycerol 3-phosphate binding

    • Motif 3: Examine the conserved histidine, asparagine, and glutamate residues critical for activity and structural integrity

  • Mutation types to consider:

    • Conservative substitutions (e.g., Ser→Thr) to assess the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Ser→Ala) to completely remove functional groups

    • Charge reversal mutations to test electrostatic interactions

A systematic experimental design should include:

  • Generation of single-site mutations across all conserved domains

  • Creation of double or triple mutants to assess synergistic effects

  • Expression and purification of all mutant proteins under identical conditions

  • Comprehensive kinetic analysis comparing wildtype and mutant proteins

  • Structural analysis where possible to correlate functional changes with structural alterations

How does plsY activity correlate with A. phagocytophilum growth and infection cycles?

The activity and expression of bacterial membrane biosynthesis proteins like plsY likely correlate with specific stages of the A. phagocytophilum lifecycle. Drawing parallels from studies on other A. phagocytophilum proteins such as PleC and PleD, a synchronized expression pattern can be anticipated. Research has shown that PleC and PleD are upregulated during the exponential growth stage and downregulated prior to extracellular release . This suggests that membrane biosynthesis proteins including plsY may follow similar expression patterns.

To investigate this correlation, researchers should design experiments that:

  • Quantify plsY expression at different stages of infection using:

    • qRT-PCR for transcript levels

    • Western blot with specific antibodies for protein expression

    • Reporter fusions to monitor expression in real-time

  • Correlate expression with bacterial growth phases:

    • Initial attachment and entry

    • Intracellular replication (exponential phase)

    • Pre-release stage

    • Extracellular phase

A comprehensive study should include infection of human cell lines such as HL-60 promyelocytic cells, which are commonly used for A. phagocytophilum research . Time-course experiments with synchronized infections would provide the most valuable data regarding the relationship between plsY activity and bacterial lifecycle progression.

What potential inhibitors can be developed against A. phagocytophilum plsY?

Developing inhibitors against A. phagocytophilum plsY represents a promising approach for therapeutic intervention. Structure-based drug design strategies should focus on the three conserved motifs critical for plsY function, with particular emphasis on:

  • Targeting the glycerol 3-phosphate binding site in Motif 2:

    • Design competitive inhibitors that mimic glycerol 3-phosphate structure

    • Develop compounds that interact with the conserved glycines identified in previous mutagenesis studies

  • Exploring non-competitive inhibition mechanisms:

    • Investigate palmitoyl-CoA derivatives, as palmitoyl-CoA has been shown to non-competitively inhibit plsY

    • Screen for compounds that induce conformational changes in the protein

  • Rational drug design approach:

    • Create a homology model of A. phagocytophilum plsY based on known bacterial plsY structures

    • Perform virtual screening of compound libraries against the model

    • Validate top hits using in vitro enzymatic assays

The effectiveness of potential inhibitors should be evaluated using a tiered testing approach:

  • Primary screening: In vitro enzymatic assays with recombinant plsY

  • Secondary screening: Cell-based assays measuring inhibition of A. phagocytophilum growth in HL-60 cells

  • Advanced testing: Analysis of membrane phospholipid composition in treated vs. untreated bacteria

Inhibitor ClassTarget MotifExpected EffectEvaluation Method
Substrate analogsMotif 2Competitive inhibitionEnzyme kinetics
Acyl-CoA derivativesMultiple sitesNon-competitive inhibitionEnzyme inhibition assays
Small molecule inhibitorsMotif 1, 3Disruption of catalytic activityHigh-throughput screening
Peptide-based inhibitorsProtein-protein interaction sitesPrevention of complex formationCo-immunoprecipitation

How can recombinant plsY be used to study host-pathogen interactions during A. phagocytophilum infection?

Recombinant plsY can serve as a valuable tool for investigating the complex host-pathogen interactions during A. phagocytophilum infection. Strategic experimental approaches include:

  • Immunological studies:

    • Develop antibodies against recombinant plsY to track protein localization during infection

    • Assess host immune response to plsY through T-cell activation assays and antibody production measurement

    • Investigate whether plsY epitopes are recognized by host pattern recognition receptors

  • Protein-protein interaction studies:

    • Perform pull-down assays using recombinant plsY to identify host protein binding partners

    • Employ yeast two-hybrid or proximity labeling techniques to map interaction networks

    • Validate interactions using co-immunoprecipitation from infected cells

  • Functional studies in infection models:

    • Compare infection dynamics between wildtype bacteria and those with modified plsY expression

    • Assess whether recombinant plsY administered exogenously affects infection outcomes

    • Evaluate the impact of anti-plsY antibodies on bacterial attachment and entry

These approaches should be implemented using appropriate infection models, such as human HL-60 cells, which have been successfully used in previous A. phagocytophilum research . When designing these experiments, researchers should consider the timing of plsY expression during the bacterial lifecycle, as membrane biosynthesis proteins may be differentially regulated during distinct infection phases.

What is the relationship between plsY activity and antimicrobial resistance in A. phagocytophilum?

The relationship between plsY activity and antimicrobial resistance in A. phagocytophilum represents an important area for investigation, particularly as membrane composition can significantly impact drug penetration and efflux. Research approaches should address:

  • Membrane composition analysis:

    • Compare phospholipid profiles between antibiotic-sensitive and resistant strains

    • Assess whether altered plsY activity correlates with specific membrane composition changes

    • Investigate if plsY expression levels differ in resistant versus sensitive strains

  • Regulation of plsY in response to antimicrobial exposure:

    • Measure plsY expression changes following sub-lethal antibiotic treatment

    • Determine if altered plsY activity represents an adaptive response to antimicrobial pressure

    • Investigate potential transcriptional regulators controlling plsY expression during stress

  • Experimental approaches:

    • Generate A. phagocytophilum strains with modified plsY expression (if genetic manipulation is possible)

    • Evaluate antimicrobial susceptibility profiles of these strains

    • Use recombinant plsY enzymes with varying activities to reconstruct membrane systems in vitro

The interplay between membrane composition and drug resistance is complex, potentially involving:

  • Changes in membrane fluidity affecting drug penetration

  • Alterations in membrane charge impacting interaction with cationic antimicrobials

  • Modifications in lipid composition affecting membrane protein function, including drug efflux pumps

Careful experimental design should include relevant controls and multiple antimicrobial agents to establish whether observed effects are specific to certain drug classes or represent a more general resistance mechanism.

What are the optimal conditions for expressing and purifying recombinant A. phagocytophilum plsY?

Optimizing the expression and purification of recombinant A. phagocytophilum plsY requires addressing the challenges inherent to membrane proteins. Based on research with similar membrane-bound enzymes, the following methodological approach is recommended:

  • Expression system selection:

    • E. coli strains C41(DE3) or C43(DE3) designed for membrane protein expression

    • Alternative expression hosts such as Pichia pastoris for complex membrane proteins

    • Cell-free expression systems supplemented with lipid nanodiscs or detergent micelles

  • Expression vector design:

    • Incorporate fusion tags (His6, MBP, SUMO) to enhance solubility and facilitate purification

    • Include protease cleavage sites for tag removal

    • Consider codon optimization for the expression host

  • Induction and growth conditions:

    • Low-temperature induction (16-20°C) to minimize inclusion body formation

    • Extended induction periods (18-24 hours)

    • Media supplementation with glycerol and specific phospholipids

  • Membrane preparation and solubilization:

    • Gentle cell disruption methods (French press or sonication)

    • Screening of multiple detergents (DDM, LDAO, CHAPS) for optimal solubilization

    • Detergent concentration optimization to maintain protein activity

  • Purification strategy:

    • Sequential chromatography: IMAC followed by size exclusion

    • On-column detergent exchange during purification

    • Activity assays at each purification step to track functional protein

The success of purification should be assessed through:

  • SDS-PAGE and western blotting to confirm protein identity and purity

  • Size exclusion chromatography to verify monodispersity

  • Activity assays to confirm retention of enzymatic function

  • Circular dichroism to evaluate secondary structure integrity

How can researchers effectively design experiments to study plsY in the context of A. phagocytophilum infection?

Designing rigorous experiments to study plsY in the context of A. phagocytophilum infection requires careful consideration of both molecular and cellular techniques. A comprehensive experimental design should include:

  • Temporal expression analysis:

    • Synchronize A. phagocytophilum infection in host cells (e.g., HL-60)

    • Collect samples at defined time points corresponding to key infection stages

    • Quantify plsY expression using qRT-PCR and western blotting

    • Correlate expression with bacterial growth curves and morphological changes

  • Localization studies:

    • Generate fluorescently tagged plsY constructs if genetic manipulation is possible

    • Alternatively, use immunofluorescence with anti-plsY antibodies

    • Perform co-localization studies with markers for bacterial compartments

    • Implement super-resolution microscopy for detailed subcellular localization

  • Functional studies:

    • Develop conditional expression systems or antisense RNA approaches if direct gene knockout is challenging

    • Assess the impact of altered plsY expression on:

      • Bacterial growth kinetics

      • Membrane composition

      • Susceptibility to host defense mechanisms

      • Antibiotic sensitivity profiles

  • Control considerations:

    • Include appropriate controls for each experimental technique

    • Use multiple cell types to ensure observations are not cell-type specific

    • Compare results with other bacterial membrane biosynthesis enzymes

    • Validate key findings using multiple complementary approaches

The experimental design should adhere to the six key concepts of experimental design, including clearly defined variables, control of confounding factors, and appropriate statistical analysis methods to ensure robust and reproducible results .

How should researchers interpret conflicting data regarding plsY function in different bacterial species?

When confronted with conflicting data regarding plsY function across different bacterial species, researchers should implement a systematic approach to data analysis and interpretation:

  • Phylogenetic analysis framework:

    • Construct comprehensive phylogenetic trees of plsY sequences from diverse bacterial species

    • Map functional differences onto phylogenetic relationships

    • Identify evolutionary patterns that might explain functional divergence

  • Structural comparison methodology:

    • Align plsY protein sequences with focus on the three conserved motifs

    • Compare available structural data or generate homology models

    • Identify species-specific structural features that might explain functional differences

  • Experimental validation approach:

    • Design chimeric proteins swapping domains between species with differing functions

    • Perform complementation studies in appropriate bacterial systems

    • Conduct in vitro assays under identical conditions for direct comparison

  • Data integration strategy:

    • Implement a scoring system to weigh evidence quality from different studies

    • Consider methodological differences that might explain conflicting results

    • Develop testable hypotheses that could reconcile apparent contradictions

When analyzing conflicting data, researchers should consider:

  • Host-specific adaptations might drive functional differences

  • Experimental conditions could significantly impact observed activities

  • Differences in protein partners or regulatory mechanisms might explain functional variations

  • Post-translational modifications might differ between species

The methodological approach should emphasize reproducibility, with key experiments repeated under standardized conditions to resolve conflicting observations .

What statistical approaches are most appropriate for analyzing plsY enzymatic activity data?

  • Enzyme kinetics analysis:

    • Fit activity data to appropriate kinetic models (Michaelis-Menten, allosteric, etc.)

    • Calculate key parameters (Km, Vmax, kcat) using non-linear regression

    • Compare parameters across experimental conditions using:

      • ANOVA with post-hoc tests for multiple comparisons

      • t-tests for pairwise comparisons with appropriate corrections

  • Inhibition studies analysis:

    • Determine inhibition types through Lineweaver-Burk or Hanes-Woolf plots

    • Calculate inhibition constants (Ki) using appropriate equations

    • Implement global fitting approaches for complex inhibition mechanisms

  • Experimental validation and quality control:

    • Calculate coefficient of variation (%CV) for technical and biological replicates

    • Implement outlier detection methods (Grubbs' test, Dixon's Q test)

    • Use power analysis to determine appropriate sample sizes

  • Advanced statistical considerations:

    • Account for non-normal distributions with appropriate transformations or non-parametric tests

    • Apply mixed-effect models when analyzing data with multiple variables

    • Implement Bayesian approaches for complex datasets with prior information

Analysis TypeStatistical MethodApplication
Parameter comparisonANOVA with Tukey's testCompare Km/Vmax across multiple conditions
Dose-responseFour-parameter logistic regressionIC50 determination for inhibitors
Time-courseRepeated measures ANOVAActivity changes over time
Structure-activityMultiple regression/QSARCorrelate structural features with activity

Researchers should prioritize transparency in reporting statistical methods, including sample sizes, p-values, confidence intervals, and effect sizes to enable proper interpretation and reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.