Recombinant Anaplasma phagocytophilum Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
lspA; APH_1160; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Anaplasma phagocytophilum (strain HZ)
Target Names
lspA
Target Protein Sequence
MRKSIIGIIVLHVVMALDQISKLYMSKLYAAHGDITVFEYCNLIQLWNKGISFGLFSTLE NGNTVFMVLSAVIIAILSYTKIKTKSMSRSCCLSVIVGGALGNLMDRLRFGAVYDFIDLH IGDWHWPAFNLADLTITCGVIVFLAMELRKRSQLNA
Uniprot No.

Target Background

Function
This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Anaplasma phagocytophilum and why is lipoprotein signal peptidase important to its pathophysiology?

Anaplasma phagocytophilum is a tick-transmitted obligate intracellular bacterium belonging to the family Anaplasmataceae. It causes human granulocytic anaplasmosis (HGA), a potentially severe to fatal disease transmitted primarily through Ixodes species ticks . A. phagocytophilum preferentially infects neutrophils, forming characteristic inclusion bodies called morulae .

Lipoprotein signal peptidase (lspA) is a membrane-bound protease essential for bacterial lipoprotein biosynthesis. It cleaves the signal peptide from preprolipoproteins, allowing their proper targeting and insertion into the cell membrane . This process is critical for bacterial survival as lipoproteins play crucial roles in:

  • Adhesion to host cells

  • Nutrient uptake

  • Antibiotic resistance mechanisms

  • Virulence factor expression

  • Immune evasion strategies

Research has demonstrated that lipoprotein processing by signal peptidase II (SPase II, encoded by lspA) is necessary for the survival of gram-negative bacteria . Unlike many other bacteria, A. phagocytophilum lacks lipopolysaccharides and peptidoglycans, compensating for this structural deficit by incorporating cholesterol into its membrane . This makes its lipoproteins particularly important for maintaining membrane integrity and facilitating host-pathogen interactions.

What are the methodological approaches for cloning and expressing recombinant A. phagocytophilum lspA?

The cloning and expression of recombinant A. phagocytophilum lspA requires specialized techniques due to the organism's obligate intracellular nature. Based on successful methodologies used with related Anaplasma species, the following protocol has proven effective:

Experimental Protocol for Cloning and Expression:

  • Isolation of Genomic DNA:

    • Obtain A. phagocytophilum from infected cell cultures (HL-60 or ISE6 tick cells)

    • Extract whole genomic DNA using commercial kits optimized for intracellular bacteria

    • Verify DNA purity and concentration using NanoDrop™ spectrophotometry

  • PCR Amplification of Target Gene:

    • Design specific primers flanking the lspA gene sequence

    • Incorporate appropriate restriction enzyme sites at primer ends

    • Perform PCR using high-fidelity DNA polymerase to minimize mutations

    • Verify amplicon size by gel electrophoresis (~438 bp for truncated lspA based on A. marginale model)

  • Cloning Strategy:

    • Digest PCR product and expression vector with appropriate restriction enzymes

    • Ligate the digested PCR product into the expression vector

    • Transform competent E. coli cells with the recombinant plasmid

    • Select transformants on antibiotic-containing media

    • Confirm positive clones via colony PCR and plasmid isolation

  • Expression in Heterologous System:

    • Induce protein expression in E. coli using IPTG or similar inducer

    • Optimize expression conditions (temperature, induction time, media composition)

    • Harvest cells and lyse using appropriate buffer systems

    • Purify recombinant protein using affinity chromatography (typically His-tag purification)

This methodology was successfully employed in similar studies with A. marginale lspA, resulting in recombinant protein with high purity and yield .

How can recombinant lspA be used in diagnostics for human granulocytic anaplasmosis?

Recombinant A. phagocytophilum lspA offers significant potential for improving HGA diagnostics, particularly during early infection stages when serological tests often yield false negatives .

Diagnostic Applications:

  • Serological Assays:

    • Enzyme-linked immunosorbent assays (ELISAs) utilizing recombinant lspA can detect anti-lspA antibodies in patient sera

    • Western blot confirmation tests using purified recombinant lspA improve specificity

    • Immunofluorescence assays incorporating recombinant lspA provide visual confirmation

  • Molecular Detection Methods:

    • Recombinant lspA serves as positive control material for PCR-based diagnostic assays

    • The protein can be used to generate and validate lspA-specific primers and probes

    • Recombinant protein standards enable quantification in molecular diagnostic tests

  • Recombinase Polymerase Amplification (RPA):

    • Novel isothermal DNA amplification assays targeting lspA genes offer improved sensitivity

    • RPA assays can detect as little as one genome equivalent copy of A. phagocytophilum

    • These techniques reliably detect 125 bacteria/ml in human blood with 100% sensitivity for previously diagnosed cases

  • Comparative Diagnostic Performance:

Diagnostic MethodSensitivitySpecificityTime to ResultSample Type
Conventional PCR60-85%95-100%3-4 hoursWhole blood
Real-time PCR85-95%95-100%1-2 hoursWhole blood
RPA targeting multicopy genes>95%>99%15-20 minutesWhole blood
Serology (acute phase)25-60%90-95%24-48 hoursSerum
Serology (convalescent)80-90%90-95%24-48 hoursSerum

Recombinant lspA-based diagnostics are particularly valuable during early infection when antibody levels are still low, potentially revolutionizing early detection strategies for HGA .

What is the role of lipoproteins in A. phagocytophilum's membrane integrity and function?

A. phagocytophilum possesses a unique membrane structure that fundamentally differs from typical Gram-negative bacteria, with lipoproteins playing crucial roles in maintaining membrane integrity and mediating host interactions.

Membrane Structure and Lipoprotein Functions:

  • Compensatory Membrane Components:

    • A. phagocytophilum lacks lipopolysaccharides (LPS) and peptidoglycans typically found in Gram-negative bacteria

    • Instead, it incorporates host cholesterol into its membrane to maintain structural integrity

    • Lipoproteins processed by lspA serve as critical structural components of this atypical bacterial membrane

  • Immune Evasion Mechanisms:

    • The absence of LPS and peptidoglycans allows A. phagocytophilum to escape recognition by host pattern recognition receptors, including Nod-Like Receptors and certain Toll-Like Receptors

    • Processed lipoproteins contribute to this molecular mimicry, helping the bacterium avoid immune surveillance

    • This strategy permits successful infection of vertebrate immune cells despite their defensive capabilities

  • Host Cell Interaction:

    • Surface-exposed lipoproteins function as adhesins that facilitate binding to host cell receptors

    • Lipoproteins like p44/Msp2 serve as the immunodominant outer membrane proteins, with over 80 paralogs encoded throughout the genome

    • These proteins enable A. phagocytophilum to adhere to host cells and prevent host immune surveillance

  • Nutrient Acquisition Pathway:

    • A. phagocytophilum depends on cholesterol for survival and infection but lacks genes for cholesterol biosynthesis or modification

    • The bacterium acquires cholesterol exclusively from the host LDL uptake pathway

    • Properly processed lipoproteins are essential for cholesterol trafficking to Anaplasma inclusions

The molecular interaction between lipoproteins and host cholesterol demonstrates the sophisticated adaptation strategies employed by A. phagocytophilum to survive within host cells despite its limited biosynthetic and metabolic capacities .

What experimental models are most effective for studying A. phagocytophilum infection and testing lspA inhibitors?

Various experimental models have been developed to study A. phagocytophilum infection and evaluate potential lspA inhibitors, each with specific advantages and limitations.

In Vitro Models:

  • Cell Culture Systems:

    • HL-60 human promyelocytic cells - Standard model for human isolates of A. phagocytophilum

    • ISE6 tick cells - Derived from Ixodes scapularis embryonated eggs, useful for studying the vector stage of the pathogen

    • RF/6A endothelial cells - Alternative mammalian cell line that supports A. phagocytophilum growth

    • THP-1 cells - Human monocytic cell line used to study specific P44 protein expression patterns

  • Culture Conditions:

    • HL-60 cells require maintenance in RPMI 1640 medium supplemented with 10% heat-inactivated FBS, 2 mM L-glutamine, 0.25% NaHCO₃, and 25 mM HEPES at 37°C in 5% CO₂

    • ISE6 cells require L-15B300 medium supplemented with 5% FBS, 5% tryptose phosphate broth, and 0.1% bovine lipoprotein concentrate

  • Inhibitor Testing Platform:

    • The acid lipase inhibitor orlistat has shown significant inhibition of Anaplasma replication

    • Cell-based assays measuring bacterial load via qPCR targeting the msp4 gene provide quantitative assessment of inhibitor efficacy

In Vivo Models:

  • Mouse Models:

    • Mice with high blood cholesterol show more severe clinical signs and 10-fold higher bacterial loads compared to normal cholesterol levels

    • CD13 knockout mice show poor infection by A. phagocytophilum, demonstrating the importance of specific host factors

  • Sheep Experimental Infection:

    • The Romane and PreAlps sheep models allow study of both acute and persistent A. phagocytophilum infection

    • Enables investigation of tick-mammal-tick transmission cycle

  • Tick-Mammal Transmission Model:

    • Complete experimental cycle includes infection of sheep with A. phagocytophilum propagated in tick cells, Ixodes ricinus infestation, and transmission to naive sheep

    • Allows study of natural transmission dynamics and bacterial adaptations during host switching

Methodological Comparison of Experimental Models:

Model SystemAdvantagesLimitationsApplications for lspA Studies
HL-60 cellsWell-established, human-relevantMay not reflect tissue specificityPrimary screening of lspA inhibitors
ISE6 tick cellsModels vector stageSlower growth, specialized media requiredStudy of lspA expression during vector stage
Mouse modelsIntact immune system, in vivo dynamicsSpecies differences from human diseaseIn vivo validation of lspA inhibitors
Sheep modelsNatural host, chronic infection possibleResource-intensive, limited reagents availableNatural infection dynamics and pathogenesis
Tick-mammal transmissionComplete life cycle representationComplex, technically challengingComprehensive pathogen biology across hosts

For lspA inhibitor testing, a multi-stage approach starting with HL-60 cell-based screening followed by validation in mouse models offers the most efficient research strategy .

How does A. phagocytophilum invade host cells, and what role might lspA play in this process?

A. phagocytophilum employs a sophisticated multistep process to invade host cells, with several surface proteins and host cell receptors involved. While the direct role of lspA in invasion is not fully elucidated, its function in processing lipoproteins is critical for the expression of functional invasins.

Invasion Mechanism:

  • Initial Attachment:

    • A. phagocytophilum adheres to host cells using multiple surface-exposed proteins known as adhesins

    • The bacterium's surface proteins interact with specific host cell ligands to facilitate internalization

    • Cholesterol-enriched lipid rafts on host cells play a critical role in A. phagocytophilum internalization

  • Key Bacterial Invasins:

    • Asp14 (14-kDa A. phagocytophilum surface protein) - Expression is significantly upregulated during cellular invasion

    • OmpA - Works in concert with other bacterial ligands to promote cellular invasion via redundant and/or complementary routes

    • AipA (A. phagocytophilum invasion protein A) - Orchestrates entry by binding to CD13 (aminopeptidase N) on host cells

    • p44/Msp2 proteins - Function as adhesins and are encoded by over 80 paralogs dispersed throughout the genome

  • Host Cell Receptors and Signaling:

    • CD13 - Interacts with AipA, specifically with residues 9-21 (AipA 9-21)

    • When the AipA-CD13 interaction occurs, it induces Src kinase phosphorylation, which is essential for A. phagocytophilum infection

    • While Syk signaling is also activated, it appears to be dispensable for invasion

  • Role of lspA in Invasion:

    • lspA processes preprolipoproteins to mature lipoproteins, which include key adhesins and invasins

    • Properly processed lipoproteins are essential for the bacterium's surface protein display

    • Inhibition of lipoprotein processing would likely disrupt the bacterium's ability to express functional invasins on its surface

Experimental Evidence of Host-Pathogen Interactions:

Researchers have shown that disrupting the AipA-CD13 interaction with either AipA 9-21 antibodies or CD13 781-967 antibodies inhibits both Src/Syk phosphorylation and bacterial infection . Additionally, CD13 crosslinking antibody that induces Src and Syk signaling can restore infectivity of anti-AipA 9-21-treated A. phagocytophilum .

These findings highlight the complex interplay between bacterial surface proteins (processed by lspA) and host cell receptors during the invasion process, making lspA an attractive target for therapeutic intervention.

What techniques are used to detect and quantify A. phagocytophilum in research and clinical samples?

Accurate detection and quantification of A. phagocytophilum are crucial for both research and clinical diagnosis. Several techniques have been developed, ranging from traditional microscopy to advanced molecular methods.

Detection and Quantification Methods:

  • Microscopic Examination:

    • Light microscopy of blood smears stained with Giemsa or Wright's stain to visualize morulae within neutrophils

    • Immunofluorescence assay (IFA) using specific antibodies against A. phagocytophilum antigens

    • Cells are fixed in 4% paraformaldehyde–0.0075% glutaraldehyde, permeabilized with ice-cold 0.3% NP-40, and incubated with specific antibodies

  • Serological Methods:

    • IFA using A. phagocytophilum cultured in THP-1 or HL-60 cells as antigens

    • Western blot analysis using recombinant P44 proteins (rP44-60, rP44-47E, rP44-18ES) expressed in an E. coli system

    • Enzyme-linked immunosorbent assays (ELISAs) utilizing recombinant antigens

  • Molecular Detection:

    • Conventional PCR targeting genes such as msp4, 16S rRNA, or p44/msp2

    • Quantitative PCR (qPCR) allowing precise quantification of bacterial load

    • Samples are processed according to established protocols, and DNA concentration is evaluated with a NanoDrop™ 2000

    • The A. phagocytophilum target gene (e.g., msp4) is amplified using specific primers, and the host gene (e.g., Ovis aries aldolase B gene for sheep samples) is used for normalization

  • Recombinase Polymerase Amplification (RPA):

    • Novel isothermal DNA amplification method targeting multicopy sequences within the genome

    • Bioinformatics analysis identified a 171-bp DNA fragment within msp2 with 16 copies in the A. phagocytophilum HZ strain and 12-21 copies in other strains

    • This method has an analytical limit of detection of one genome equivalent copy and can reliably detect 125 bacteria/ml in human blood

  • Cell Culture Isolation:

    • Propagation of A. phagocytophilum in permissive cell lines such as HL-60 or ISE6

    • Monitoring infection levels by cytospin preparations and Giemsa staining

    • Confirmation by PCR or immunostaining

Comparative Analysis of Detection Methods:

MethodSensitivitySpecificityTurnaround TimeSample RequirementsApplications
MicroscopyLow-moderate (>10⁵ bacteria/ml)ModerateMinutes-hoursBlood smearsRapid screening, morphology
SerologyLow (acute), High (convalescent)High1-2 daysSerumPast exposure, epidemiology
Conventional PCRModerate (10³-10⁴ bacteria/ml)High4-6 hoursWhole blood, tissuesConfirmation, species identification
qPCRHigh (10²-10³ bacteria/ml)High2-3 hoursWhole blood, tissuesQuantification, kinetics studies
RPAVery high (1 copy)Very high15-20 minutesWhole bloodRapid diagnosis, field studies
Cell cultureModerateVery highDays-weeksBlood, tissuesIsolation, propagation, antibiotic testing

The RPA assay, targeting multicopy sequences, represents a significant advancement in A. phagocytophilum detection, combining exceptional sensitivity (100% detection in previously diagnosed cases) with rapid results and high specificity .

What is known about the three-dimensional structure of A. phagocytophilum lspA and how does it compare to lspA from other bacteria?

The three-dimensional structure of A. phagocytophilum lspA has not been experimentally determined, but computational models and comparative analysis with related bacterial lspA proteins provide insights into its likely structural features and functional domains.

Predicted Structural Features:

  • Domain Organization:

    • Lipoprotein signal peptidases (lspA) are typically membrane-bound proteases with 4-5 transmembrane domains

    • The catalytic domain contains conserved serine and lysine residues forming the catalytic dyad

    • The N-terminal region contains hydrophobic transmembrane segments that anchor the protein to the bacterial membrane

  • Comparative Analysis:

    • Multiple sequence alignment of lspA from A. phagocytophilum with other bacterial species reveals conserved catalytic residues

    • The protein likely shares structural similarities with other type II signal peptidases

    • Key differences may exist in substrate recognition regions, reflecting the unique lipoprotein profile of A. phagocytophilum

  • Membrane Topology:

    • Based on hydropathy plot analysis, A. phagocytophilum lspA likely contains 4-5 transmembrane domains

    • The catalytic domain is predicted to be oriented toward the periplasmic space

    • This orientation would allow access to lipoprotein substrates following their transport across the cytoplasmic membrane

Functional Implications:

  • Substrate Specificity:

    • A. phagocytophilum lspA recognizes and cleaves the signal peptide from preprolipoproteins at a conserved lipobox motif

    • The enzyme likely shows preference for specific amino acid sequences at positions -3 to +2 relative to the cleavage site

    • This specificity may be adapted to the unique set of lipoproteins expressed by A. phagocytophilum

  • Potential Inhibition Strategies:

    • Knowledge of the predicted active site architecture can guide the design of specific inhibitors

    • Targeting unique structural features of A. phagocytophilum lspA could provide selective inhibition

    • Molecular docking studies with known lspA inhibitors could identify compounds with therapeutic potential

While the detailed structural information for A. phagocytophilum lspA is limited, the conservation of key functional domains across bacterial species suggests that it maintains the core catalytic mechanism while potentially harboring unique features adapted to the organism's specialized intracellular lifestyle and unique membrane composition.

How does A. phagocytophilum evade host immune responses, and what role might lspA play in this process?

A. phagocytophilum employs sophisticated strategies to evade host immune responses, with processed lipoproteins playing critical roles in this evasion. While the direct contribution of lspA has not been fully characterized, its function in processing lipoproteins makes it integral to these immune evasion mechanisms.

Immune Evasion Strategies:

  • Unique Membrane Composition:

    • A. phagocytophilum lacks lipopolysaccharides and peptidoglycans typically found in Gram-negative bacteria

    • This absence allows the bacterium to escape detection by Nod-Like Receptors and certain Toll-Like Receptors

    • The bacterium incorporates host cholesterol to compensate for the loss of these structural components

  • Antigenic Variation:

    • The p44/msp2 multigene family encodes multiple 44-kDa immunodominant major outer membrane proteins (P44)

    • Gene conversion generates antigenic variations in these surface proteins

    • The bacterium expresses predominantly different p44/msp2 transcripts in different cell types (THP-1 vs. HL-60 cells)

    • This variation helps evade antibody-mediated immunity and facilitates persistence in reservoir hosts

  • Manipulation of Host Cell Function:

    • A. phagocytophilum delays host cell apoptosis by activating anti-apoptosis cascades

    • This is critical for intracellular survival in normally short-lived neutrophil granulocytes

    • The bacterium modulates the distribution of potential host cells and infected neutrophils by inducing cytokine secretion

    • It promotes the loss of CD162 and CD62L, affecting neutrophil trafficking and function

  • Role of lspA in Immune Evasion:

    • lspA processes lipoproteins that contribute to the bacterium's unique membrane structure

    • Properly processed lipoproteins likely contribute to molecular mimicry that helps avoid immune surveillance

    • lspA-processed surface proteins may interfere with host signaling pathways that would otherwise activate immune responses

  • Host Immune Pathways Targeted:

    • Despite evading many pattern recognition receptors, studies in mice have shown that alternative pathways involving Nod 1 and 2 associated receptor interacting protein 2 may be important in controlling A. phagocytophilum infection

    • The bacterium appears to interfere with these pathways, but the specific mechanisms and potential role of lspA remain to be fully elucidated

The essential role of lspA in processing lipoproteins that mediate these immune evasion strategies makes it a potential therapeutic target. Inhibition of lspA could compromise multiple aspects of A. phagocytophilum's immune evasion capabilities, potentially facilitating clearance by host defenses.

What are the challenges in expressing and purifying recombinant A. phagocytophilum proteins for structural and functional studies?

Expressing and purifying recombinant A. phagocytophilum proteins, including lspA, presents several unique challenges due to the organism's obligate intracellular lifestyle, specialized membrane composition, and the intrinsic properties of membrane proteins.

Technical Challenges and Solutions:

  • Obtaining Gene Sequences:

    • Challenge: Limited availability of pure bacterial DNA due to obligate intracellular lifestyle

    • Solution: Cultivation in specialized cell lines (HL-60, ISE6) followed by differential centrifugation to enrich bacterial cells

    • Alternative: Synthetic gene synthesis based on published genome sequences, with codon optimization for expression systems

  • Expression System Selection:

    • Challenge: Membrane proteins like lspA often show toxicity to host cells when overexpressed

    • Solution: Use of regulated expression systems (e.g., T7 promoter with lac operator control) to minimize basal expression

    • Options: E. coli BL21(DE3)pLysS or C41/C43(DE3) strains specifically designed for membrane protein expression

  • Protein Solubility Issues:

    • Challenge: Membrane proteins like lspA tend to form inclusion bodies when overexpressed

    • Solution: Expression at lower temperatures (16-20°C) and reduced inducer concentrations

    • Alternative Approaches:

      • Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

      • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

      • In vitro refolding from inclusion bodies using detergent screens

  • Membrane Protein Purification:

    • Challenge: Maintaining native structure during extraction from membranes

    • Solution: Screening multiple detergents (DDM, LDAO, MNG-3) for optimal extraction and stability

    • Technique: Two-step purification using affinity chromatography followed by size exclusion chromatography

  • Functional Verification:

    • Challenge: Assessing enzymatic activity of recombinant lspA

    • Solution: Development of in vitro assays using synthetic peptide substrates containing lipobox motifs

    • Approach: Fluorescence-based assays measuring peptide cleavage or mass spectrometry to detect reaction products

Case Study: Purification Protocol for Recombinant A. phagocytophilum lspA

Based on successful approaches with other bacterial lspA proteins and membrane proteins from related organisms, the following protocol has been effective:

  • Expression Strategy:

    • Clone lspA gene into pET28a vector with N-terminal 10× His tag

    • Transform into E. coli C43(DE3) cells

    • Grow at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5 mM IPTG and continue growth at 18°C for 16-18 hours

  • Membrane Preparation:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF

    • Lyse cells by sonication or microfluidizer

    • Remove unbroken cells and debris (10,000 × g, 20 min, 4°C)

    • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Protein Extraction and Purification:

    • Solubilize membranes in buffer containing 1% DDM or 1% LDAO

    • Remove insoluble material by ultracentrifugation

    • Purify using Ni-NTA affinity chromatography with detergent in all buffers

    • Further purify by size exclusion chromatography

  • Functional Verification:

    • Assess purity by SDS-PAGE (>80% purity typical for well-optimized protocols)

    • Verify identity by Western blotting and mass spectrometry

    • Test enzymatic activity using synthetic peptide substrates

This approach has successfully generated purified recombinant proteins from A. phagocytophilum and related species with sufficient yields for structural and functional studies.

How can structural biology approaches be applied to develop inhibitors targeting A. phagocytophilum lspA?

The development of specific inhibitors targeting A. phagocytophilum lspA requires a structural biology-guided approach. Despite limited structural information specifically for A. phagocytophilum lspA, comparative analysis and rational design strategies can enable inhibitor development.

Structure-Based Inhibitor Design Workflow:

  • Target Structure Determination:

    • Homology Modeling: Generate 3D models of A. phagocytophilum lspA based on known structures of homologous bacterial lspA proteins

    • Model Validation: Assess model quality using Ramachandran plots, ProCheck, and molecular dynamics simulations

    • Active Site Mapping: Identify catalytic residues and substrate binding pockets based on sequence conservation and structural analysis

  • Virtual Screening Approaches:

    • Structure-Based Virtual Screening: Dock libraries of small molecules against the active site of modeled lspA

    • Pharmacophore-Based Screening: Develop pharmacophore models based on known lspA inhibitors and essential binding features

    • Fragment-Based Design: Identify small molecular fragments that bind to different regions of the active site

  • In Vitro Validation:

    • Enzymatic Assays: Test top virtual hits against purified recombinant lspA using fluorogenic peptide substrates

    • Binding Studies: Confirm direct binding using thermal shift assays, isothermal titration calorimetry, or surface plasmon resonance

    • Structure-Activity Relationship Analysis: Systematically modify promising hits to improve potency and selectivity

  • Cellular Evaluation:

    • Efficacy Assessment: Test compounds in A. phagocytophilum-infected cell cultures (HL-60, ISE6)

    • Mechanism Verification: Confirm that inhibition is due to lspA targeting by examining lipoprotein processing

    • Cytotoxicity Testing: Evaluate potential toxicity against uninfected mammalian cells

Known Chemical Classes with lspA Inhibitory Activity:

Inhibitor ClassMechanism of ActionAdvantagesLimitationsDevelopment Status
β-lactonesIrreversible acylation of active site serineHigh potency, covalent inhibitionPotential off-target effectsPreclinical studies
ArylomycinsCompetitive inhibition of signal peptide bindingNatural product derivatives, specific activityComplex synthesisEarly development
GlobomycinCompetitive inhibitionWell-characterized activity against lspALimited selectivityUsed as reference compound
Synthetic peptidesSubstrate mimicryHigh specificity potentialPoor cell penetrationResearch tools

Case Study: Orlistat as a Model for lspA Inhibitor Development

Orlistat, an acid lipase inhibitor, has demonstrated significant inhibition of Anaplasma replication . Though its primary target is not lspA, its mechanism of action provides insights for lspA inhibitor design:

  • Mechanism Analysis:

    • Orlistat contains a β-lactone ring that forms a covalent bond with the active site serine of lipases

    • Similar reactive groups could be incorporated into lspA inhibitor designs to target the catalytic serine

  • Structure Optimization:

    • The hydrophobic tail of orlistat could be modified to better fit the substrate binding pocket of lspA

    • Adding groups that interact with specific residues in A. phagocytophilum lspA could improve selectivity

  • Delivery Considerations:

    • Lipophilic compounds like orlistat can penetrate bacterial membranes

    • Similar physicochemical properties should be maintained in lspA inhibitor development

These structural biology approaches provide a systematic framework for developing specific inhibitors targeting A. phagocytophilum lspA, potentially leading to novel therapeutic agents for human granulocytic anaplasmosis.

What is the current understanding of lipoprotein maturation in A. phagocytophilum and how does it compare to other bacteria?

Lipoprotein maturation in bacteria is a highly conserved process, but A. phagocytophilum displays unique aspects of this pathway that reflect its specialized intracellular lifestyle and distinctive membrane composition.

Canonical Lipoprotein Maturation Pathway:

In Gram-negative bacteria, lipoprotein maturation typically involves three sequential enzymatic steps:

  • Preprolipoprotein Diacylglyceryl Transferase (Lgt):

    • Transfers diacylglyceryl from phosphatidylglycerol to the sulfhydryl group of the cysteine in the lipobox

    • Creates a thioether linkage that anchors the protein to the membrane

  • Lipoprotein Signal Peptidase (LspA):

    • Cleaves the signal peptide at the N-terminus of the diacylglyceryl-modified cysteine

    • This processing is essential for proper lipoprotein localization and function

  • Lipoprotein N-Acyltransferase (Lnt):

    • Adds a third acyl chain to the N-terminus of the mature lipoprotein

    • This step is typically required for lipoprotein sorting to the outer membrane in Gram-negative bacteria

phagocytophilum Lipoprotein Maturation:

  • Genome Analysis:

    • A. phagocytophilum possesses genes encoding Lgt and LspA but appears to lack a conventional Lnt homolog

    • This suggests potentially modified processing of lipoproteins compared to typical Gram-negative bacteria

  • Unique Features:

    • The truncated LSP gene of related Anaplasma marginale has been cloned and sequenced, providing insights into potential structural and functional characteristics in A. phagocytophilum

    • The absence of peptidoglycans in A. phagocytophilum may influence the physical environment in which lipoprotein maturation occurs

  • Role in Membrane Structure:

    • A. phagocytophilum incorporates host cholesterol into its membrane to compensate for the lack of lipopolysaccharides and peptidoglycans

    • This unique membrane composition likely influences the final localization and orientation of mature lipoproteins

  • Functional Importance:

    • Bacterial lipoprotein biosynthesis is considered an attractive target for novel antibiotic drug discovery

    • Studies have shown that lipoprotein processing by lspA is necessary for the survival of Gram-negative bacteria

Comparative Analysis:

FeatureTypical Gram-negative BacteriaA. phagocytophilumImplications
LgtPresentPresentBasic lipid modification maintained
LspAPresentPresentSignal peptide cleavage preserved
LntPresentAppears absentModified sorting mechanism likely
Membrane destinationInner and outer membranesSingle membrane systemSimplified trafficking pathways
Membrane compositionLPS and peptidoglycan presentCholesterol-enriched, lacks LPS and peptidoglycanDifferent membrane environment for mature lipoproteins

This unique lipoprotein maturation pathway in A. phagocytophilum reflects its evolutionary adaptation to an intracellular lifestyle and contributes to its ability to survive within host cells while evading immune detection.

How can advanced proteomics techniques be applied to study the role of lspA and lipoproteins in A. phagocytophilum infection?

Advanced proteomics techniques offer powerful tools to investigate the role of lspA and lipoproteins in A. phagocytophilum infection, particularly given the challenges of studying this obligate intracellular pathogen.

State-of-the-Art Proteomics Approaches:

  • Surface Proteome Analysis:

    • Selective Biotinylation: Surface proteins can be selectively labeled with biotin, purified with NeutrAvidin affinity chromatography, and identified by mass spectrometry

    • Application: This approach identified Asp14 as a surface protein upregulated during A. phagocytophilum cellular invasion

    • Trypsin Digestion: Limited proteolysis of intact bacteria can confirm which proteins are exposed on the cell surface

  • Comparative Proteomics:

    • Quantitative Proteomics: Label-free or isotope labeling techniques (SILAC, TMT, iTRAQ) can compare protein expression levels between:

      • Infected vs. uninfected host cells

      • Different stages of bacterial development (DC vs. RC forms)

      • Wild-type vs. lspA inhibitor-treated bacteria

    • Experimental Design: Sample collection at multiple time points post-infection can reveal dynamic changes in the proteome

  • Interactome Analysis:

    • Pull-Down Assays: GFP-tagged bacterial proteins can identify host binding partners

    • Example: EgeA-GFP was found to bind TANGO1, a transmembrane protein in the ER

    • Yeast Two-Hybrid Analysis: This technique identified that the bacterial effector EgeA-C directly binds SCFD1, a host protein of the cis-Golgi network

    • Co-Immunoprecipitation: Validates protein-protein interactions, as demonstrated with AipA binding to CD13

  • Post-Translational Modification Analysis:

    • Lipoprotein Identification: Mass spectrometry can identify lipid modifications on proteins

    • Methodology: Specialized extraction methods with detergents followed by sensitive MS/MS analysis can detect lipid-modified peptides

    • Application: Comparing wild-type and lspA inhibitor-treated samples can identify lspA substrates

Experimental Protocol for Comprehensive Lipoproteomic Analysis:

  • Sample Preparation:

    • Isolate A. phagocytophilum from infected HL-60 cells by differential centrifugation

    • Treat parallel cultures with lspA inhibitors to identify processing-dependent changes

    • Extract proteins using specialized detergent mixtures optimized for membrane proteins

  • Proteomic Workflow:

    • Digest proteins with trypsin or multiple proteases for improved coverage

    • Fractionate peptides using high-pH reversed-phase chromatography

    • Analyze by nano-LC-MS/MS on high-resolution instruments (Orbitrap or similar)

    • Search against A. phagocytophilum and host protein databases with modifications for lipidation

  • Bioinformatic Analysis:

    • Identify proteins with lipobox motifs and signal peptides

    • Compare abundance and processing state between conditions

    • Perform pathway and functional enrichment analysis

    • Correlate with transcriptomic data if available

  • Validation Studies:

    • Generate antibodies against identified lipoproteins

    • Perform immunofluorescence localization studies

    • Create recombinant versions of identified proteins for functional testing

Case Study: Proteomic Analysis of A. phagocytophilum Invasins

The identification of Asp14 as an A. phagocytophilum surface protein highly upregulated during invasion demonstrates the power of proteomics approaches :

  • Methodology Used:

    • Dense-cored (DC) forms of A. phagocytophilum were subjected to selective biotinylation

    • NeutrAvidin affinity purification isolated surface-exposed proteins

    • Mass spectrometry identified the protein components

    • Transcriptional profiling verified temporal expression patterns

  • Key Findings:

    • Asp14 expression was significantly upregulated during cellular invasion

    • Transcript levels were also induced during tick feeding

    • This coordinated expression pattern highlighted the protein's role in invasion

Similar comprehensive proteomic approaches could identify the full complement of lipoproteins processed by lspA and determine their specific roles in A. phagocytophilum infection, potentially revealing new therapeutic targets.

What role do tick vectors play in the transmission and biology of A. phagocytophilum, and how can this inform therapeutic approaches?

Ticks serve as both vectors and biological hosts for A. phagocytophilum, significantly influencing the bacterium's transmission dynamics, gene expression, and protein processing. Understanding these interactions can inform novel therapeutic approaches targeting the pathogen during transmission or early infection.

Tick-Pathogen Interactions:

  • Vector Species and Distribution:

    • A. phagocytophilum is primarily transmitted by Ixodes species ticks, particularly I. scapularis in North America and I. ricinus in Europe

    • These ticks also transmit other pathogens, including Borrelia burgdorferi and Babesia species, leading to potential co-infections

  • Transmission Dynamics:

    • Experimental models have successfully recreated the complete I. ricinus-sheep cycle of A. phagocytophilum

    • Pathogen acquisition occurs during feeding on infected hosts, followed by transstadial transmission (survival through molting)

    • Transmission to new hosts occurs during subsequent blood meals

  • Bacterial Adaptations During Tick Stages:

    • A. phagocytophilum exhibits different gene expression patterns in tick cells compared to mammalian cells

    • The asp14 gene is specifically upregulated during transmission feeding of infected ticks

    • p44/msp2 expression varies between mammalian and tick cell environments, with restricted transcription in tick cells

  • Experimental Models:

    • ISE6 tick cells derived from I. scapularis embryonated eggs serve as an in vitro model for studying A. phagocytophilum in the arthropod vector

    • Complete experimental cycles including infection of sheep with A. phagocytophilum, I. ricinus infestation, and transmission to naive sheep allow study of the full transmission cycle

Therapeutic Implications:

  • Transmission-Blocking Strategies:

    • Targeting upregulated bacterial proteins during tick feeding (like Asp14) could prevent initial host cell invasion

    • Vaccine candidates could include recombinant forms of tick-stage specific A. phagocytophilum proteins

    • Disrupting the cholesterol acquisition pathway could inhibit bacterial replication during transmission events

  • Vector Control Approaches:

    • Acaricides and tick repellents remain important preventive measures

    • Ecological interventions targeting tick habitats can reduce transmission risk

    • Host-targeted applications that treat wildlife reservoirs may reduce infection rates in tick populations

  • Diagnostic Considerations:

    • Recombinase Polymerase Amplification (RPA) assays targeting multicopy genes can detect A. phagocytophilum with extremely high sensitivity (one genome equivalent copy)

    • Such highly sensitive methods are valuable for detecting early infections immediately following tick transmission

    • Detection in ticks can serve as an environmental surveillance tool

Research Protocol: Studying lspA Expression During Tick-Mammal Transmission

Based on established methodologies, the following protocol can determine how lspA expression and function change during transmission:

  • Sample Collection:

    • Establish laboratory colonies of Ixodes ticks

    • Feed larval ticks on A. phagocytophilum-infected animals

    • Allow molting to nymphal stage

    • Collect nymphs before feeding (unfed) and at different time points during feeding (24h, 48h, 72h)

  • Expression Analysis:

    • Extract RNA from tick samples at each time point

    • Perform RT-qPCR targeting lspA and key lipoprotein genes

    • Compare expression profiles with those from in vitro tick cell cultures

  • Protein Analysis:

    • Perform immunofluorescence assays on tick salivary glands using anti-lspA antibodies

    • Extract proteins for Western blot analysis of lspA and processed lipoproteins

    • Compare lipoprotein processing efficiency at different transmission stages

  • Functional Studies:

    • Apply lspA inhibitors to feeding ticks and measure impact on transmission efficiency

    • Evaluate early mammalian infection when lspA is inhibited during the transmission phase

    • Test whether immune responses to specific lipoproteins can block transmission

This research approach can identify critical points in the tick-mammal transmission cycle where targeting lspA or its substrates would most effectively disrupt A. phagocytophilum transmission and establishment of infection.

How can genomic and transcriptomic analyses enhance our understanding of lspA function in A. phagocytophilum?

Genomic and transcriptomic analyses provide powerful tools to investigate lspA function in A. phagocytophilum, offering insights into its expression patterns, potential substrates, and evolutionary significance within the context of the bacterium's obligate intracellular lifestyle.

Genomic Analysis Approaches:

  • Comparative Genomics:

    • Analysis of lspA gene sequences across different A. phagocytophilum strains reveals conservation levels and selective pressures

    • Comparison with lspA from other Anaplasmataceae family members (A. marginale, A. centrale) identifies unique features

    • Phylogenetic analysis can trace the evolution of lspA in relation to bacterial adaptation to different hosts

  • Lipoprotein Prediction:

    • Bioinformatic tools can identify putative lipoproteins in the A. phagocytophilum genome by detecting signal peptides and lipobox motifs

    • The analysis of the A. phagocytophilum HZ strain genome revealed numerous paralogs of p44/msp2, with at least 22 in the Webster strain and 52 in the HZ strain

    • This approach identifies the complete set of potential lspA substrates

  • Genomic Context Analysis:

    • Examination of genes adjacent to lspA can reveal functional relationships

    • Analysis of operon structures may indicate co-regulated processes

    • Identification of regulatory elements could explain expression patterns

Transcriptomic Analysis Strategies:

  • Expression Profiling:

    • RNA-Seq analysis of A. phagocytophilum during different stages of infection reveals temporal expression patterns of lspA and lipoprotein genes

    • Transcriptional profiling of selected outer membrane protein candidates showed that asp14 expression was significantly upregulated during cellular invasion

    • Expression analysis in different host cell types (HL-60 vs. ISE6 tick cells) reveals host-specific adaptations

  • Differential Expression Analysis:

    • Comparing expression between infectious dense-cored (DC) and noninfectious reticulate cell (RC) forms identifies stage-specific lipoprotein processing requirements

    • Analysis during tick feeding shows that asp14 transcription is induced during transmission, highlighting stage-specific expression

    • Restricted msp2 transcription observed over many passages and in tick cells suggests selection by fitness for new niches

  • Single-Cell Transcriptomics:

    • Analysis of gene expression heterogeneity within bacterial populations

    • Identification of subpopulations with distinct expression profiles

    • Correlation of expression patterns with infection outcomes

Research Protocol: Integrated Genomic and Transcriptomic Analysis

The following protocol illustrates how to integrate genomic and transcriptomic approaches to comprehensively analyze lspA function:

  • Genome Comparison:

    • Sequence lspA and flanking regions from multiple A. phagocytophilum isolates from different hosts (human, ruminant, rodent)

    • Perform whole-genome alignment to identify strain-specific variations

    • Use tools like PRED-LIPO or LipoP to predict the complete lipoprotein repertoire

  • Transcriptome Profiling:

    • Culture A. phagocytophilum in both HL-60 and ISE6 cells

    • Collect samples at multiple time points (early, mid, late infection)

    • Extract RNA and perform RNA-Seq analysis

    • Map reads to the genome and quantify expression levels

  • Integration and Analysis:

    • Correlate lspA expression with predicted lipoprotein genes

    • Identify co-expression networks using tools like WGCNA

    • Validate key findings with RT-qPCR for selected genes

    • Compare results with proteomic data if available

  • Experimental Validation:

    • Create reporter constructs with promoters of interest

    • Test the effect of different conditions on expression

    • Use RNA interference or inhibitors to assess the impact of lspA inhibition on global gene expression

Case Study: Transcriptional Analysis of p44/msp2 Genes

The p44/msp2 multigene family encoding multiple 44-kDa immunodominant outer membrane proteins illustrates the power of transcriptomic analysis in understanding A. phagocytophilum biology:

  • Key Findings:

    • A. phagocytophilum expresses predominantly different p44/msp2 transcripts in different cell types (THP-1 vs. HL-60 cells)

    • The bacterium shows antigenic variation due to gene conversion in these surface proteins

    • This variation is likely driven by immune selection and plays a role in persistence among reservoir hosts

  • Implications for lspA Function:

    • The processing of these variable lipoproteins by lspA is essential for their proper localization and function

    • lspA activity must be maintained across different host environments despite varying substrate profiles

    • Inhibition of lspA would affect the entire repertoire of surface-exposed lipoproteins, potentially disrupting multiple aspects of the bacterium's life cycle

These genomic and transcriptomic approaches provide a comprehensive view of lspA's role in A. phagocytophilum biology, revealing its importance in processing diverse lipoproteins across different life cycle stages and host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.