Recombinant Anas platyrhynchos ATP synthase subunit a (MT-ATP6)

What is MT-ATP6 and what is its function in Anas platyrhynchos?

MT-ATP6 (also known as ATP synthase subunit a) is a protein encoded by the mitochondrial genome in Anas platyrhynchos (domestic duck). It forms an essential component of the F₀ portion of ATP synthase. The protein functions as part of the proton pathway, working in conjunction with the c-subunit ring to facilitate proton transport across the inner mitochondrial membrane. This transport is coupled to the rotation of the c-ring, which drives ATP synthesis in the F₁ domain of the complex .

The complete amino acid sequence of the Anas platyrhynchos MT-ATP6 protein is:
MNLSFFDQFSSPHLLGHPLILLSLLLPALLFPSPGNRWINNRLSTIQLWLLHLITKQLMI PLNKNGHKWALMLTSLMTMLLTINLLGLLPYTFTPTTQLSMNMALAFPLWLATLLTGLRN KPSASLAHLLPEGTPTPLIPALILIETTSLLIRPLALGVRLTANLTAGHLLIQLISTASI ALKPILPTVSILTMAILLLLTILEVAVAMIQAYVFVLLLSLYLQENI

How does the structure of Anas platyrhynchos MT-ATP6 compare to other species?

The MT-ATP6 protein structure is highly conserved across vertebrates, suggesting its fundamental importance in energy production. Comparing the Anas platyrhynchos MT-ATP6 (227 amino acids) with that of Petromyzon marinus (sea lamprey, 237 amino acids), we observe conservation in key functional domains despite some sequence variations .

Both proteins maintain similar structural elements:

• Two transmembrane α-helices

• A short connecting loop region

• Conserved functional residues essential for proton translocation

This conservation reflects evolutionary pressure to maintain the proton transport function across species. Notably, certain residues such as glutamate-58 (in the bovine sequence) are particularly conserved as they play a critical role in the proton translocation mechanism necessary for ATP synthesis .

What are the optimal expression systems for producing recombinant Anas platyrhynchos MT-ATP6?

The optimal expression system for recombinant Anas platyrhynchos MT-ATP6 depends on the research objectives. While E. coli is commonly used for basic protein expression as seen with similar proteins , researchers should consider the following methodological considerations:

For structural studies:

• Bacterial expression systems (E. coli) offer high yield but may lack post-translational modifications

• Insect cell systems (Sf9, High Five) provide better protein folding for membrane proteins

• Mammalian expression systems (HEK293, CHO cells) offer superior post-translational modifications

Expression optimization protocol:

• Clone the MT-ATP6 sequence with appropriate tags (His-tag is commonly used)

• Transform into the selected expression system

• Optimize induction conditions (temperature, induction time, inducer concentration)

• Extract using detergent solubilization (recommended: n-dodecyl β-D-maltoside)

• Purify using affinity chromatography followed by size exclusion chromatography

For functional studies requiring native-like membrane environment, consider nanodiscs or liposome reconstitution following purification .

What are the critical considerations for storage and handling of recombinant MT-ATP6 protein?

The hydrophobic nature of MT-ATP6 presents unique challenges for storage and handling. Based on established protocols for similar proteins, researchers should:

• Store the lyophilized protein at -20°C for long-term storage or at -80°C for extended preservation

• Avoid repeated freeze-thaw cycles, as these can significantly degrade membrane protein integrity

• For working aliquots, store at 4°C for no longer than one week

• When reconstituting, use buffer systems containing:

  • 50 mM Tris-HCl, pH 7.5

  • 150 mM NaCl

  • 10% glycerol as a stabilizing agent

  • 0.05-0.1% suitable detergent (DDM or LMNG recommended)

• Monitor protein stability using techniques such as circular dichroism or tryptophan fluorescence

What methods are most effective for measuring the functional activity of recombinant MT-ATP6?

Several complementary approaches can be employed to assess MT-ATP6 functionality:

Proton Translocation Assays:

• Reconstitute purified protein into liposomes containing pH-sensitive fluorescent dyes

• Establish a pH gradient across the membrane

• Monitor fluorescence changes as a measure of proton transport

• Calculate transport rates based on calibration curves

ATP Synthesis Measurements:

• Incorporate MT-ATP6 into proteoliposomes containing the complete ATP synthase complex

• Establish a proton gradient using acid-base transition or valinomycin-induced K+ diffusion

• Add ADP and Pi

• Quantify ATP production using luciferase-based luminescence assays

• Compare synthesis rates between wild-type and variant proteins

Complementation Studies:
Yeast complementation assays have proven particularly valuable for functional assessment of MT-ATP6 variants. The procedure involves:

• Introducing the Anas platyrhynchos MT-ATP6 gene into ATP6-deficient yeast strains

• Assessing restoration of respiratory growth on non-fermentable carbon sources

• Measuring mitochondrial membrane potential

• Quantifying oxygen consumption rates

How can researchers effectively identify and characterize MT-ATP6 interactions with other subunits in the ATP synthase complex?

Characterizing the interactions between MT-ATP6 and other ATP synthase subunits requires sophisticated approaches:

Cross-linking Combined with Mass Spectrometry:

• Apply membrane-permeable cross-linking agents to stabilize transient interactions

• Isolate the cross-linked complexes

• Perform proteolytic digestion

• Analyze cross-linked peptides using high-resolution mass spectrometry

• Map interaction interfaces based on identified cross-linked residues

Cryo-electron Microscopy:

• Purify intact ATP synthase complexes

• Prepare vitrified samples for cryo-EM analysis

• Collect high-resolution image data

• Perform 3D reconstruction to visualize subunit arrangements

• Dock atomic models to identify specific interaction points between MT-ATP6 and other subunits

Mutagenesis Studies:
Systematic mutagenesis of conserved residues can reveal critical interaction points. Researchers can:

• Generate point mutations in conserved regions

• Express and purify variant proteins

• Assess complex assembly using blue native PAGE

• Evaluate functional consequences using activity assays

• Compare results with structural predictions to refine interaction models

What approaches can be used to model pathogenic MT-ATP6 mutations in experimental systems?

The study of MT-ATP6 mutations can be approached through several complementary systems:

Yeast Models:
Saccharomyces cerevisiae provides an excellent platform for studying MT-ATP6 mutations due to:

• Amenability to mitochondrial genetic transformation

• Inability to maintain heteroplasmy (mixed wild-type/mutant mtDNA populations)

• Clear respiratory phenotypes when ATP synthesis is compromised

Implementation protocol:

• Introduce equivalent mutations to those identified in human patients into the yeast ATP6 gene

• Assess respiratory growth on non-fermentable carbon sources

• Measure mitochondrial ATP synthesis rates

• Evaluate proton translocation efficiency

• Examine assembly of the ATP synthase complex

Cell Culture Models:
Transmitochondrial cybrid cell lines can be created by:

• Depleting cells of endogenous mtDNA

• Repopulating with mitochondria containing MT-ATP6 mutations

• Selecting cells with desired mutation load

• Analyzing ATP production rates

• Measuring mitochondrial membrane potential

• Assessing cellular respiration using Seahorse analyzers

What are the most significant pathogenic mutations identified in MT-ATP6 and how do they affect protein function?

Several mutations in MT-ATP6 have been associated with human mitochondrial diseases, and these can provide insights for comparative studies in Anas platyrhynchos MT-ATP6:

m.8993T>G (L156R) Mutation:

• Most common pathogenic mutation

• Replaces conserved leucine with arginine

• Effects:

  • Dramatically compromises respiratory growth

  • Causes ~90% reduction in mitochondrial ATP synthesis

  • Disrupts proton flow through the ATP synthase

Other Pathogenic Mutations:
Based on yeast modeling studies, several mutations have demonstrated clear pathogenicity:

• m.8950G>A: Significant defect in respiration-dependent growth

• m.9025G>A: Substantial deficits in ATP production

• m.9029A>G: Compromised mitochondrial function

These mutations affect protein function through mechanisms including:

• Disruption of proton transport pathway

• Interference with c-ring rotation

• Alteration of subunit interactions

• Destabilization of protein structure

How can post-translational modifications of MT-ATP6 be identified and characterized?

Post-translational modifications (PTMs) can significantly impact MT-ATP6 function. Advanced techniques for PTM identification include:

Mass Spectrometry-Based Approaches:

• Purify MT-ATP6 protein using affinity chromatography

• Perform proteolytic digestion (trypsin, chymotrypsin, or combined approaches)

• Enrich for modified peptides (IMAC for phosphopeptides, lectin affinity for glycopeptides)

• Analyze using high-resolution LC-MS/MS with electron transfer dissociation (ETD)

• Process data using specialized PTM search algorithms

Site-Directed Mutagenesis to Confirm PTM Sites:

• Generate mutants where potential modification sites are replaced with non-modifiable residues

• Compare function between wild-type and mutant proteins

• Assess impact on ATP synthesis, assembly, and stability

Of particular interest is the potential trimethylation of lysine residues in the loop regions, as this modification has been observed in the c-subunit (lysine-43) of bovine ATP synthase and appears conserved across vertebrates .

What are the current challenges in structural studies of MT-ATP6 and how can they be addressed?

Structural characterization of MT-ATP6 faces several challenges that require advanced approaches:

Challenges:

• High hydrophobicity making crystallization difficult

• Instability when removed from membrane environment

• Dynamic nature of interactions within the ATP synthase complex

• Difficulty in expressing sufficient quantities of functional protein

Advanced Solutions:

• Lipidic Cubic Phase Crystallization:

  • Incorporates membrane proteins into lipidic mesophases

  • Maintains native-like environment during crystal formation

  • Allows for more stable protein conformation

• Single-Particle Cryo-EM:

  • Bypass need for crystallization

  • Preserve protein in near-native state

  • Capture different conformational states

  • Recent advances allow for near-atomic resolution

• Integrative Structural Biology Approaches:

  • Combine multiple techniques (X-ray crystallography, NMR, cryo-EM)

  • Use cross-linking mass spectrometry to identify constraints

  • Apply molecular dynamics simulations to model dynamic regions

  • Validate models through functional studies

How does Anas platyrhynchos MT-ATP6 compare functionally to other avian and mammalian homologs?

Comparative analysis of MT-ATP6 across species provides valuable insights into functional conservation and adaptation:

Sequence Conservation Analysis:
The high degree of sequence conservation between Anas platyrhynchos MT-ATP6 and other vertebrate homologs suggests fundamental functional constraints. Key features include:

• Conservation of essential residues involved in proton translocation

• Preservation of transmembrane topology with two alpha-helical domains

• Similar loop regions connecting transmembrane segments

Functional Comparison:
Studies of ATP synthase from different species have revealed:

• Vertebrate ATP synthases typically contain 8 c-subunits per ring, resulting in an energy cost of 2.7 protons per ATP molecule

• This represents the lowest observed "energy cost" for ATP production

• The conservation of this parameter across vertebrates suggests evolutionary optimization of energy efficiency

What insights can be gained from studying the evolutionary conservation of specific MT-ATP6 residues?

Evolutionary analysis of MT-ATP6 provides critical insights for structure-function studies:

Identification of Critical Functional Residues:

• Highly conserved residues across diverse species often indicate functional importance

• The equivalent of glutamate-58 in bovine subunit a is critical for proton translocation

• Conservation of specific arginine residues in adjacent a-subunits highlights their role in the proton pathway

Coevolution Analysis:

• Identify co-evolving residue pairs using statistical coupling analysis

• Map these onto structural models to identify functional interactions

• Target these residues for mutagenesis studies to validate predicted interactions

Adaptation to Environmental Niches:

• Analyze species-specific variations in MT-ATP6 in context of environmental adaptations

• Examine potential correlations between sequence variations and physiological demands

• Consider temperature adaptation, metabolic rate, and other species-specific factors that may influence ATP synthase function