Recombinant Anas platyrhynchos Cytochrome c oxidase subunit 1 (MT-CO1)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant MT-CO1 is synthesized in E. coli using optimized expression protocols . Commercial suppliers include:

SupplierProduct CodePrice (USD)Key Features
MyBioSource.com$1,365.00Full-length protein
Creative BiomartRFL10358AFNot disclosed1–102 aa, His-tagged, E. coli expression
CusabioCSB-CF015072BZDPartial sequence variants available
American Science$1,443.00ELISA-compatible formulation

Production involves fermentation in E. coli, followed by purification via nickel-affinity chromatography due to the His-tag .

Key Applications

Recombinant MT-CO1 is utilized in:

Evolutionary and Taxonomic Research

  • DNA Barcoding: The COI gene’s rapid evolution rate makes it ideal for distinguishing avian species, including Anas platyrhynchos .

  • Phylogenetic Analysis: Sequence comparison of COI variants aids in tracing evolutionary relationships among waterfowl .

Mitochondrial Function Studies

  • Electron Transport Chain Modeling: MT-CO1’s role in oxygen reduction and proton pumping is critical for understanding avian mitochondrial metabolism .

Species Identification

A study on Central Javanese ducks demonstrated that COI gene sequencing reliably distinguishes native and domesticated populations, highlighting its utility in conservation genetics .

Protein Stability and Interactions

  • MITRAC Complex: MT-CO1 interacts with COA3 and SMIM20/MITRAC7 to stabilize its assembly in mitochondria, preventing premature degradation .

  • Antibody Cross-Reactivity: While human MT-CO1 antibodies (e.g., ab203917) target conserved regions, cross-reactivity with Anas platyrhynchos MT-CO1 requires validation .

Disease Associations

Though not directly linked to Anas platyrhynchos, human MT-CO1 mutations correlate with:

  • Leber’s Hereditary Optic Neuropathy (LHON)

  • Mitochondrial Complex IV Deficiency

  • Sensorineural Deafness .

Associated Studies and Disease Links

While the recombinant Anas platyrhynchos MT-CO1 lacks direct disease associations, its structural homology to human MT-CO1 informs comparative studies on mitochondrial dysfunction. For example:

  • Mutations in Human MT-CO1: Linked to impaired oxygen reduction and ATP synthesis, underscoring the protein’s conserved role across species .

  • Avian Mitochondrial Diseases: Research on avian MT-CO1 may provide insights into analogous human conditions, such as myopathies or neurodegenerative disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is preferred, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-CO1; COI; COXI; MTCO1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Anas platyrhynchos (Mallard) (Anas boschas)
Target Names
Target Protein Sequence
MTFINRWLFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQIYNVIVT RHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (MT-CO1) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient across the inner mitochondrial membrane that drives transmembrane transport and the function of ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO1 and what is its biological significance?

MT-CO1, or mitochondrially encoded cytochrome c oxidase I, is a critical component of the mitochondrial electron transport chain. It functions within complex IV on the mitochondrial inner membrane, where it facilitates the transfer of electrons to oxygen, producing water and contributing to ATP synthesis—a process essential for cellular energy production . The gene is conserved across species, including Anas platyrhynchos (Mallard duck), making it valuable for comparative studies in evolutionary biology and bioenergetics. The protein's central role in cellular respiration makes it a key target for research into metabolic disorders and mitochondrial dysfunction.

How does MT-CO1 in Anas platyrhynchos compare to human MT-CO1?

While both human and Anas platyrhynchos MT-CO1 serve the same fundamental function in the respiratory chain, they exhibit species-specific sequence variations that reflect evolutionary adaptations. These differences are particularly important when selecting appropriate antibodies and detection methods for research. Commercial antibodies specifically designed for Anas platyrhynchos MT-CO1 are available to ensure accurate detection in mallard-specific research . When conducting comparative studies, researchers should be aware that cross-reactivity between human and avian antibodies is limited, necessitating species-specific reagents for optimal results.

What expression patterns of MT-CO1 are observed in different tissues?

MT-CO1 expression varies significantly across different tissues and is influenced by factors such as age and physiological state. Research using mouse models has demonstrated that non-immune organs (heart, lung, liver, kidneys, and intestines) show distinct expression patterns compared to immune organs (lymph nodes, spleen, and thymus) . For instance, studies in MRL/lpr mice showed increased MT-CO1 expression in younger specimens for non-immune organs, but decreased expression in older specimens . These tissue-specific expression patterns reflect the varying energy demands and mitochondrial activity across different organ systems. When studying MT-CO1 in Anas platyrhynchos, researchers should anticipate similar tissue-specific variations.

What detection methods are available for MT-CO1 in avian species?

Several validated methods exist for detecting MT-CO1 in avian species:

  • Protein Detection: Western blot analysis using specific antibodies against MT-CO1, with protein extracted via RIPA buffer and quantified using BCA assays .

  • mRNA Analysis: Quantitative PCR (qPCR) to measure MT-CO1 gene expression levels .

  • Immunohistochemistry: Visualization of MT-CO1 in tissue sections using specific antibodies.

  • Immunofluorescence: Fluorescent detection of MT-CO1 in cellular preparations.

The selection of detection method should be based on experimental objectives, with consideration for sensitivity, specificity, and the type of data required.

How can researchers effectively produce and purify recombinant Anas platyrhynchos MT-CO1?

Producing recombinant MT-CO1 from Anas platyrhynchos requires specialized approaches due to its hydrophobic nature and mitochondrial localization. The recommended protocol involves:

  • Gene Optimization: Codon optimization for the expression system of choice, typically E. coli or insect cells.

  • Expression Vector Selection: Vectors containing strong promoters and appropriate fusion tags (His, GST, or MBP) to enhance solubility and facilitate purification.

  • Expression Conditions: Typically, lower temperatures (16-20°C) and reduced inducer concentrations improve proper folding.

  • Purification Strategy: Sequential chromatography methods, including affinity chromatography followed by size exclusion chromatography.

For validation, SDS-PAGE analysis can confirm protein integrity, with expected bands for partial MT-CO1 visible on Tris-Glycine gels with 5% enrichment gel and 15% separation gel . Researchers should note that recombinant MT-CO1 often requires detergent-based buffers during purification to maintain stability due to its membrane protein characteristics.

What factors influence MT-CO1 expression and activity in experimental models?

Multiple factors can modulate MT-CO1 expression and activity in experimental settings:

  • Oxidative Stress: Increased malondialdehyde (MDA) levels correlate with altered MT-CO1 expression, suggesting a relationship between oxidative damage and MT-CO1 dysfunction .

  • Inflammatory Stimuli: High lipopolysaccharide (LPS) concentrations (1.5 mg/L) significantly induce MT-CO1 mRNA and protein expression after 24 hours of exposure .

  • Age-Related Changes: Expression patterns differ substantially between young and old specimens, with most non-immune tissues showing decreased MT-CO1 expression in older subjects .

  • Tissue-Specific Regulation: Different organs exhibit distinct regulatory mechanisms controlling MT-CO1 expression, likely reflecting tissue-specific energy demands.

When designing experiments, researchers should control for these variables to ensure consistent and interpretable results. Standardization of experimental conditions is particularly important when studying MT-CO1 in relation to aging or inflammatory processes.

How can researchers distinguish between species-specific variants of MT-CO1 in mixed biological samples?

Distinguishing between MT-CO1 variants from different species requires specialized approaches:

  • DNA Barcoding: MT-CO1 is commonly used as a DNA barcode for species identification. PCR amplification followed by sequencing can differentiate between species.

  • Species-Specific Antibodies: Using antibodies that recognize unique epitopes in Anas platyrhynchos MT-CO1 versus other species .

  • Mass Spectrometry: Proteomics approaches can identify species-specific peptide fragments.

  • High-Resolution Melting Analysis: This technique can distinguish between closely related species based on DNA melting temperature differences in MT-CO1 amplicons.

These approaches are particularly valuable in ecological studies, biodiversity monitoring, and forensic applications where species identification is crucial.

What are the implications of MT-CO1 mutations in mitochondrial dysfunction?

MT-CO1 mutations can significantly impact mitochondrial function through several mechanisms:

  • Reduced Complex IV Activity: Mutations can impair electron transport efficiency, leading to decreased ATP production.

  • Increased ROS Generation: Dysfunction in the electron transport chain often results in elevated reactive oxygen species, causing oxidative damage .

  • Altered Mitochondrial Dynamics: MT-CO1 mutations can affect mitochondrial fusion and fission processes.

  • Tissue-Specific Effects: The impact of mutations varies by tissue type, with high-energy-demanding tissues like heart and brain showing greater sensitivity.

Research indicates a correlation between MT-CO1 dysfunction and conditions characterized by energy metabolism disruption. In experimental models, MT-CO1 mutations have been associated with increased MDA levels, indicating oxidative stress . When studying these relationships, researchers should employ multiple methods to assess mitochondrial function, including respiratory capacity measurements, ROS detection, and ATP quantification.

What protocols are recommended for detecting MT-CO1 protein expression in tissue samples?

For optimal detection of MT-CO1 protein in tissue samples, the following methodology is recommended:

  • Tissue Preparation:

    • Process tissues on ice immediately after collection

    • Extract total protein using RIPA cell lysate buffer

    • Quantify protein concentrations using BCA protein quantitative kit

  • Western Blot Analysis:

    • Separate proteins using 10% SDS-PAGE

    • Transfer to polyvinylidene fluoride membrane

    • Block with 3% bovine serum albumin

    • Probe with primary MT-CO1 antibody (e.g., ab203912) overnight at 4°C

    • Incubate with 1:10,000 diluted secondary antibody at room temperature for 2 hours

    • Visualize using electrochemical luminescence method

    • Analyze band intensity using software such as ImageJ

  • Immunohistochemistry:

    • Use paraffin-embedded tissue sections

    • Apply MT-CO1-specific antibodies at appropriate dilutions (e.g., 1:100)

    • Include positive and negative controls to validate specificity

When analyzing results, researchers should normalize MT-CO1 expression to appropriate housekeeping proteins (e.g., β-actin) and consider tissue-specific variations in baseline expression.

What approaches should be used for studying MT-CO1 mRNA expression?

For comprehensive analysis of MT-CO1 mRNA expression, researchers should implement the following protocol:

  • RNA Isolation:

    • Extract total RNA from fresh tissue samples

    • Assess RNA quality using spectrophotometry and gel electrophoresis

    • Treat with DNase to remove genomic DNA contamination

  • Reverse Transcription:

    • Convert RNA to cDNA using reverse transcriptase

    • Include RT-negative controls to detect genomic DNA contamination

  • Quantitative PCR:

    • Design primers specific to Anas platyrhynchos MT-CO1 sequence

    • Optimize qPCR conditions (annealing temperature, primer concentration)

    • Include reference genes for normalization

    • Analyze data using appropriate methods (ΔΔCt or standard curve)

  • Data Validation:

    • Confirm specificity of amplification with melt curve analysis

    • Validate key findings with alternative methods (e.g., Northern blot)

This approach allows for sensitive and specific quantification of MT-CO1 transcript levels across different experimental conditions and tissue types .

What statistical approaches are recommended for analyzing MT-CO1 expression data?

Appropriate statistical analysis is crucial for interpreting MT-CO1 expression data:

  • Normality Testing:

    • Use Shapiro-Wilk test to verify normal distribution of data

    • Apply parametric tests for normally distributed data and non-parametric tests for non-normal distributions

  • Group Comparisons:

    • For two normally distributed groups: Independent t-test

    • For multiple groups: Analysis of variance (ANOVA) with appropriate post-hoc tests

    • For non-parametric data: Mann-Whitney U test (two groups) or Kruskal-Wallis test (multiple groups)

  • Correlation Analysis:

    • Use Pearson correlation (parametric) or Spearman correlation (non-parametric) to analyze relationships between variables

    • Particularly useful for examining associations between MT-CO1 expression and markers of oxidative stress (e.g., MDA levels)

  • Data Presentation:

    • Present data as mean ± standard deviation for normally distributed data

    • Include significance levels (p-values) and effect sizes

    • Use appropriate graphical representations (bar graphs, scatter plots) to visualize results

Statistical significance is typically set at p<0.05, though researchers should consider multiple testing corrections when appropriate .

How can MT-CO1 be used in evolutionary and phylogenetic studies?

MT-CO1 serves as a valuable marker for evolutionary and phylogenetic research due to several key characteristics:

  • Conservation Across Species: The gene is present in most eukaryotes but exhibits sufficient variation for species discrimination.

  • Molecular Clock Properties: MT-CO1 evolves at a relatively constant rate, making it useful for temporal evolutionary analyses.

  • DNA Barcoding: The gene is widely used as a standardized marker for species identification, particularly in avian taxonomy.

  • Hybridization Detection: MT-CO1 analysis can help identify hybrid individuals between Anas platyrhynchos and related species .

When using MT-CO1 for phylogenetic studies, researchers should employ appropriate sequence alignment algorithms and tree-building methods. Maximum likelihood or Bayesian approaches are typically preferred for constructing robust phylogenetic trees. The analysis of MT-CO1 in mallards is particularly valuable for understanding waterfowl evolution and hybridization patterns.

What is the relationship between MT-CO1 expression and oxidative stress?

Research has established important connections between MT-CO1 expression and oxidative stress markers:

  • Inverse Correlation: Studies in various models show an inverse relationship between MT-CO1 expression and malondialdehyde (MDA) levels, a marker of lipid peroxidation caused by oxidative stress .

  • Tissue-Specific Effects: The relationship between MT-CO1 and oxidative stress varies by tissue type and age, with non-immune tissues showing different patterns than immune tissues .

  • Mechanistic Link: Decreased MT-CO1 expression can lead to reduced complex IV activity, electron leakage, and increased ROS production, creating a potential feedback loop with oxidative damage.

  • Antioxidant Response: MT-CO1 expression changes may represent an adaptive response to oxidative conditions.

This relationship highlights the importance of monitoring both MT-CO1 expression and oxidative stress markers in experimental designs. Statistical correlations between these parameters can reveal important insights into mitochondrial dysfunction mechanisms .

How does MT-CO1 function differ in aquatic birds compared to terrestrial species?

Aquatic birds like Anas platyrhynchos (Mallard) show distinctive MT-CO1 characteristics compared to terrestrial birds:

  • Metabolic Adaptations: Aquatic birds have evolved MT-CO1 variants that support their high-energy diving and swimming behaviors.

  • Cold Adaptation: MT-CO1 in mallards exhibits functional adaptations for thermogenesis in cold water environments.

  • Tissue Distribution: Expression patterns across tissues may reflect the specialized metabolic demands of aquatic lifestyle.

  • Hypoxia Tolerance: Modifications in MT-CO1 structure and function may contribute to enhanced tolerance of temporary hypoxia during diving.

These adaptations make Anas platyrhynchos MT-CO1 particularly interesting for comparative studies examining mitochondrial evolution in response to environmental pressures. Researchers investigating these differences should consider experimental designs that directly compare orthologous MT-CO1 function across phylogenetically diverse bird species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.