Recombinant Anas platyrhynchos Estradiol 17-beta-dehydrogenase 12 (HSD17B12)

Shipped with Ice Packs
In Stock

Description

Introduction

Estradiol 17-beta-dehydrogenase 12 (HSD17B12) is an enzyme that plays a crucial role in steroid metabolism and the synthesis of very long-chain fatty acids (VLCFA) . It was initially identified as a key enzyme in the steroid metabolism pathway but was later recognized as the human homolog of yeast 3-ketoacyl-CoA reductase, which catalyzes the second reaction in each VLCFA elongation cycle .

General Information

PropertyDescription
Recommended NameEstradiol 17-beta-dehydrogenase 12
EC Number1.1.1.62
Alternative Name(s)17-beta-hydroxysteroid dehydrogenase 12, 17-beta-HSD 12
Gene NameHSD17B12
SynonymsSPM2
SpeciesAnas platyrhynchos (Domestic duck)
FunctionInvolved in both the biosynthesis of estradiol and the elongation of very long fatty acids . Plays an important role in female fertility through its role in arachidonic acid (AA) metabolism . Essential for proper lipid homeostasis .

Function and Significance

  1. VLCFA Synthesis: HSD17B12 interacts with elongases ELOVL1–7 and dehydratases HACD1–4 to generate diverse saturated, mono, and polyunsaturated VLCFA species . It serves as a metabolic hub in the VLCFA synthesis pathway .

  2. Lipid Metabolism: HSD17B12 is essential for proper lipid homeostasis . Deficiency of HSD17B12 can lead to a loss of body weight, reduction in white and brown fat, liver toxicity, and systemic inflammation .

  3. Female Fertility: HSD17B12 plays a crucial role in female fertility through its involvement in arachidonic acid (AA) metabolism . It is expressed in various cells in the ovary, and its haploinsufficiency in female mice results in subfertility .

  4. Viral Replication: HSD17B12 plays a role in the replication of Flaviviridae viruses, including Hepatitis C virus (HCV), Dengue virus (DENV), and Zika virus (ZIKV) . Knockdown of HSD17B12 impairs HCV RNA replication and reduces the production of infectious particles .

Impact on Cellular Processes

  • Lipid Droplet (LD) Biogenesis and Maintenance: HSD17B12 is critical for the biogenesis and maintenance of LDs, which are mainly composed of triglycerides (TGs) incorporating VLCFA . Depletion of HSD17B12 reduces the number and size of LDs and decreases oleic acid and TG levels .

  • HCV RNA Replication: HSD17B12 knockdown (KD) decreases the replication of subgenomic HCV RNA in the absence of virus assembly but unexpectedly increases intracellular viral RNA levels of HCV-infected cells .

Role in Disease

  • Cancer: A functional genetic variant of HSD17B12 in the fatty acid biosynthesis pathway predicts the outcome of colorectal cancer .

  • Viral Infections: HSD17B12 contributes to Flaviviridae virus infections, and targeting HSD17B12 may offer a broad-spectrum antiviral potential to treat and/or prevent RNA virus infections .

Studies on HSD17B12

StudyFindings
Conditional knockout mouse model HSD17B12 is essential for proper lipid homeostasis, and its deficiency leads to systemic inflammation and lipolysis in adult mice.
Mice with a null mutation of the Hsd17b12 gene HSD17B12 is involved in the synthesis of arachidonic acid and is essential for normal neuronal development during embryogenesis.
Study on the role of HSD17B12 enzyme in the ovarian function HSD17B12 plays an important role in female fertility through its role in AA metabolism. Haploinsufficiency of the HSD17B12 gene in female mice resulted in subfertility.
Investigation of the role of HSD17B12 during the replication of HCV and related flaviviruses, using HSD17B12 knockdown (KD) HSD17B12 KD impairs the ER-associated HCV RNA replication sites and reduces the number of cytoplasmic LDs. KD of HSD17B12 results in significant inhibition of HCV, DENV, and ZIKV infectious particle production, which is associated with a reduced abundance of phosphatidylethanolamine (PE), triglycerides (TG), and oleic acids in cells.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HSD17B12; SPM2; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Anas platyrhynchos (Mallard) (Anas boschas)
Target Names
HSD17B12
Target Protein Sequence
MLPAAGLLWWVGALGALYAAVRGALGLLGALRVWGIGAGRAALGPGLGAWAVVTGATDGI GKAYAKELAKRGMKVALISRSKEKLDQVAGEITEQYGVETKVIVADFGEREDIYDRIRAG LEGLEIGVLVNNVGISYSYPEYFIDVPDLDKTIDKMININIMSVCKMTRLVLPGMLERSK GVILNISSAAGMYPTPLLTLYSASKAFVDYFSRGLHAEYKSKGIIVQSVMPYYVATKMSK ISKPSFDKPTPETYVRAAIGTVGLQSQTNGCLPHAFMGWVFSILPTSTVMNLLMKTNKQI RARFLKKKMKEK
Uniprot No.

Target Background

Function

This recombinant Anas platyrhynchos Estradiol 17-beta-dehydrogenase 12 (HSD17B12) catalyzes the second step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. HSD17B12 exhibits 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each elongation cycle. This function contributes to VLCFA biosynthesis of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Additionally, HSD17B12 may catalyze estrone (E1) to estradiol (E2) conversion, playing a role in estrogen production.

Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Brain.

Q&A

What is the functional role of HSD17B12 in Anas platyrhynchos?

HSD17B12 in Anas platyrhynchos (mallard duck) serves dual enzymatic functions. Primarily, it acts as a key enzyme in the fatty acid elongation pathway, specifically functioning as a 3-ketoacyl-CoA reductase in the endoplasmic reticulum. It catalyzes the second of four reactions in the long-chain fatty acids elongation cycle, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA. This activity contributes to the production of very long-chain fatty acids (VLCFAs) that serve as precursors for membrane lipids and lipid mediators .

Additionally, HSD17B12 possesses estradiol 17-beta-dehydrogenase activity, catalyzing the conversion of estrone (E1) to estradiol (E2) in reproductive tissues, suggesting its involvement in steroid hormone metabolism .

What are the recommended storage conditions for recombinant HSD17B12?

For optimal stability and activity retention, recombinant Anas platyrhynchos HSD17B12 should be stored at -20°C/-80°C upon receipt. Proper storage procedures include:

  • Initial aliquoting to avoid repeated freeze-thaw cycles

  • Storage of working aliquots at 4°C for up to one week

  • Long-term storage in buffer containing 6% trehalose or 50% glycerol at pH 8.0

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL prior to use

Repeated freeze-thaw cycles should be strictly avoided as they can significantly reduce enzymatic activity and protein stability.

What expression systems are most effective for producing recombinant HSD17B12?

Several expression systems have been successfully used to produce functional recombinant HSD17B12, each with distinct advantages:

Expression SystemTag OptionsAdvantagesApplicationsReference
E. coliHis, GSTHigh yield, cost-effective, suitable for structural studiesSDS-PAGE, Western blotting
Wheat germGSTEnhanced folding of complex proteins, reduced inclusion body formationELISA, functional assays
Mammalian cellsHis, Fc-AviNative post-translational modifications, higher biological activityEnzymatic activity assays, protein-protein interaction studies

For studies requiring high enzymatic activity, wheat germ or mammalian expression systems are preferable despite lower yields. For structural studies or applications requiring large quantities of protein, E. coli expression systems provide higher yields but may require additional optimization for proper folding .

How can enzymatic activity of recombinant HSD17B12 be measured?

Enzymatic activity of recombinant HSD17B12 can be assessed through several methodological approaches:

  • 3-ketoacyl-CoA reductase activity assay:

    • Substrate: 3-ketoacyl-CoA derivatives

    • Detection: Spectrophotometric monitoring of NADPH oxidation at 340 nm

    • Buffer conditions: Typically Tris buffer (pH 7.4) with NADPH as cofactor

    • Controls: Heat-inactivated enzyme and reaction without substrate

  • Estradiol dehydrogenase activity assay:

    • Substrate: Estrone (E1)

    • Product detection: HPLC or LC-MS/MS quantification of estradiol (E2) formation

    • Cofactor: NADPH

    • Incubation: 37°C, typically 30-60 minutes

  • Fatty acid elongation assay:

    • Direct measurement using radiolabeled substrates and thin-layer chromatography

    • Analysis of fatty acid chain length distribution using GC-MS

    • Metabolic labeling studies using stable isotope-labeled precursors

Activity assays should include appropriate positive controls (commercially available enzymes) and negative controls (denatured enzyme) .

What purification strategies are effective for recombinant HSD17B12?

For His-tagged recombinant HSD17B12:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Buffer optimization: Tris-based buffer (pH 8.0) with 10-20 mM imidazole to reduce non-specific binding

  • Elution with 200-300 mM imidazole

  • Further purification by size exclusion chromatography if higher purity is required

For GST-tagged recombinant HSD17B12:

  • Affinity purification using glutathione-sepharose resin

  • Elution with reduced glutathione (typically 10 mM)

  • Optional tag removal using specific proteases (thrombin or PreScission)

  • Secondary purification by ion exchange chromatography

Purification should be performed at 4°C to maintain protein stability, and protease inhibitors should be included in initial lysis buffers .

How conserved is HSD17B12 across avian species compared to mammals?

HSD17B12 shows notable conservation across vertebrate species, reflecting its essential role in fatty acid metabolism. Phylogenetic analysis of Anas platyrhynchos and other species reveals:

  • The Anas platyrhynchos HSD17B12 protein shares significant sequence homology with other avian species within the mallard complex, as evidenced by phylogenetic studies of 14 closely related taxa .

  • When comparing avian and mammalian HSD17B12:

    • Catalytic domains show high conservation (>75% similarity)

    • N-terminal regions display more variation, potentially reflecting species-specific regulatory mechanisms

    • Key residues in the active site are almost invariant across vertebrates

  • Molecular clock analyses suggest that avian HSD17B12 genes evolved under different selective pressures than mammalian orthologs, likely reflecting adaptations to different metabolic requirements .

These evolutionary patterns provide valuable context for understanding both the conserved and species-specific functions of HSD17B12 across vertebrates.

What insights can HSD17B12 provide about mallard duck phylogeny?

HSD17B12 serves as one of several genetic markers used in reconstructing phylogenetic relationships within the mallard complex (Anas platyrhynchos and allies). Research findings indicate:

  • The HSD17B12 gene, along with other nuclear introns and the mtDNA control region, has been used to elucidate evolutionary relationships among 14 closely related mallard taxa .

  • Multilocus coalescent methods incorporating HSD17B12 data have helped address challenges in duck phylogeny related to:

    • Recombination events

    • Hybridization between closely related species

    • Incomplete lineage sorting

  • When combined with data from other loci, HSD17B12 sequence analysis contributes to more robust phylogenetic trees that better reflect the complex evolutionary history of the mallard complex .

The study of HSD17B12 in this context demonstrates how single-gene analyses can be integrated into broader phylogenetic frameworks to resolve challenging taxonomic questions.

What evidence exists for HSD17B12's role in metabolic regulation and disease?

Studies using conditional knockout models have revealed critical insights into HSD17B12's role in metabolism:

  • Conditional knockout mice (HSD17B12cKO) demonstrate that HSD17B12 is essential for lipid homeostasis. Gene inactivation in adult mice results in:

    • 20% body weight loss within 6 days

    • Drastic reduction in white fat (83% in males, 75% in females)

    • Reduction in brown fat (65% in males, 60% in females)

    • Markedly reduced food and water intake

  • Liver-specific effects of HSD17B12 deficiency include:

    • Microvesicular hepatic steatosis

    • Increased serum alanine aminotransferase (4.6-fold in males, 7.7-fold in females)

    • More pronounced hepatic changes in females compared to males

  • HSD17B12 deficiency triggers inflammatory responses, including increased levels of proinflammatory cytokines:

    • Interleukin-6 (IL-6)

    • Interleukin-17 (IL-17)

    • Granulocyte colony-stimulating factor

These findings underscore HSD17B12's essential role in maintaining metabolic homeostasis and suggest its potential involvement in metabolic disorders.

How is HSD17B12 implicated in cancer pathways?

Genetic and molecular studies have identified significant associations between HSD17B12 and cancer progression:

These findings suggest potential applications for HSD17B12 as a prognostic biomarker or therapeutic target in certain cancers.

What approaches are recommended for studying HSD17B12 structure-function relationships?

Advanced structural biology and molecular techniques for investigating HSD17B12 structure-function relationships include:

  • X-ray crystallography:

    • Expression of recombinant HSD17B12 with minimal flexible regions

    • Optimization of crystal growth conditions (typically using vapor diffusion methods)

    • Collection of diffraction data at synchrotron radiation facilities

    • Structure determination using molecular replacement with related dehydrogenase structures

  • Site-directed mutagenesis studies:

    • Identification of conserved catalytic residues based on sequence alignment

    • Generation of point mutations using overlap extension PCR

    • Expression and purification of mutant proteins

    • Comparative enzymatic assays to determine effects on catalytic activity and substrate specificity

  • Molecular dynamics simulations:

    • Building homology models based on related hydroxysteroid dehydrogenase structures

    • Simulation of enzyme-substrate interactions

    • Analysis of conformational changes during catalysis

    • Prediction of binding sites for potential inhibitors

These complementary approaches can provide comprehensive insights into the structural basis of HSD17B12 function in both steroid metabolism and fatty acid elongation pathways.

How can researchers investigate the impact of HSD17B12 genetic variants?

To investigate functional consequences of HSD17B12 genetic variants, researchers should consider these methodological approaches:

  • Luciferase reporter assays:

    • Synthesis of DNA fragments containing variant alleles (e.g., rs10838164 C or T)

    • Insertion into reporter vectors (e.g., pGL3-basic)

    • Co-transfection with Renilla plasmids into appropriate cell lines

    • Measurement of dual-luciferase activity to assess transcriptional effects

  • Chromatin immunoprecipitation (ChIP) assays:

    • Investigation of transcription factor binding (e.g., YY1) to regions containing variants

    • Cross-linking proteins to DNA in intact cells

    • Immunoprecipitation with antibodies against specific transcription factors

    • Analysis of enriched DNA regions by qPCR or sequencing

  • Expression quantitative trait loci (eQTL) analysis:

    • Genotyping of variants in population cohorts

    • RNA-seq or qPCR to measure gene expression levels

    • Statistical analysis to correlate genotypes with expression levels

    • Tissue-specific analyses to identify context-dependent effects

These techniques have successfully demonstrated that variants like rs10838164 T allele enhance transcriptional activity by affecting the binding of transcription factors to HSD17B12.

What are the challenges in analyzing HSD17B12 involvement in fatty acid metabolism?

Investigating HSD17B12's role in fatty acid metabolism presents several technical challenges that require specialized approaches:

  • Lipidomic profiling challenges:

    • Requirement for sensitive mass spectrometry techniques to detect changes in lipid profiles

    • Need for specialized extraction protocols to capture the full range of lipid species

    • Complex data analysis to identify relevant changes among thousands of lipid species

    • Integration of changes in specific lipid classes with biological pathways

  • Tissue-specific effects analysis:

    • Development of tissue-specific conditional knockout models

    • Temporal control of gene inactivation to distinguish developmental vs. adult phenotypes

    • Sex-specific differences in phenotypes requiring analysis of both male and female subjects

    • Complex metabolic interactions requiring multi-tissue analyses

  • Methodological solutions:

    • Serum lipidomics studies to monitor changes in circulating lipid profiles

    • Analysis of ceramides, dihydroceramides, and other sphingolipids with varying fatty acid chain lengths

    • Categorization of lipid species based on fatty acid composition

    • Integration of lipid data with inflammatory markers and other metabolic parameters

The complexity of these analyses has revealed that HSD17B12 deficiency leads to accumulation of ceramides and related lipids with shorter than 18-carbon fatty acid side chains, confirming its critical role in fatty acid elongation.

What are promising areas for future research on avian HSD17B12?

Future research on Anas platyrhynchos HSD17B12 and related avian orthologs should focus on:

  • Comparative functional genomics:

    • Systematic comparison of enzymatic activities across avian species

    • Investigation of species-specific regulatory mechanisms

    • Analysis of adaptive evolution in different avian lineages

    • Integration with broader studies of avian metabolism and physiology

  • Developmental biology applications:

    • Role of HSD17B12 in avian embryonic development

    • Sex-specific functions in reproductive biology

    • Seasonal variation in expression and activity

    • Environmental influences on HSD17B12 function

  • Applied biotechnology:

    • Development of enzyme variants with enhanced stability or altered substrate specificity

    • Exploration of potential applications in biocatalysis

    • Creation of biosensors based on HSD17B12 activity

    • Comparative analysis with industrial enzymes used in lipid modification

These directions would expand our understanding of avian biology while potentially leading to biotechnological applications of avian HSD17B12.

How might HSD17B12 research contribute to understanding plumage genetics in ducks?

Recent genomic studies suggest potential connections between lipid metabolism genes and plumage characteristics in ducks:

  • Genome-wide association studies (GWAS) have identified genes associated with white, black, and spotty plumage in ducks, including MC1R and MITF .

  • While HSD17B12 has not been directly implicated in plumage color, its role in fatty acid metabolism suggests potential involvement in:

    • Feather lipid composition affecting waterproofing and insulation

    • Fatty acid availability for pigment production pathways

    • Metabolic regulation during molt periods

  • Future research directions could include:

    • Investigation of HSD17B12 expression patterns in feather follicles during development

    • Analysis of lipid profiles in differently pigmented feathers

    • Examination of potential epistatic interactions between HSD17B12 and known plumage color genes

    • Association studies incorporating HSD17B12 variants alongside MC1R and MITF

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.