Recombinant Anas platyrhynchos NADH-ubiquinone oxidoreductase chain 1 (MT-ND1)

What is MT-ND1 and what is its function in mitochondria?

MT-ND1 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 1) is a critical component of mitochondrial respiratory complex I. In Anas platyrhynchos, it is a 117-amino acid protein with the sequence: "MPQTTMVSYLIMALLYIIPILIAVAFLTLVERKILSYMQSRKGPNIVGPFGLLQPIADGI KLFIKEPIRPSTSSPLLFIMMPMLALLLALTAWVPLPLPFSLVDLNLGVLFMVAMSS" .

Functionally, MT-ND1:

• Provides NADH dehydrogenase activity to complex I

• Participates in mitochondrial electron transport

• Contributes to the assembly of respiratory chain complex I

• Is located at the critical junction of hydrophilic and hydrophobic domains in complex I

• Contributes to both ubiquinone binding and proton pump structures

This protein is encoded by mitochondrial DNA (mtDNA) between nucleotide pairs 3307 and 4262 on the guanine-rich heavy chain, resulting in a 36 kDa protein positioned within the mitochondrial membrane .

How is recombinant MT-ND1 typically produced and purified for research?

Recombinant MT-ND1 for research purposes is typically expressed in bacterial systems, with E. coli being the predominant expression host. For the Anas platyrhynchos MT-ND1, the production methodology includes:

• Gene synthesis or cloning of the full-length sequence (1-117 amino acids)

• Insertion into an expression vector with an N-terminal His-tag

• Expression in E. coli under optimal conditions

• Cell lysis and protein extraction

• Purification via affinity chromatography using the His-tag

• Final formulation as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

The purified protein typically achieves >90% purity as determined by SDS-PAGE analysis. For experimental use, it requires reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What experimental applications is recombinant MT-ND1 commonly used for?

Recombinant MT-ND1 from Anas platyrhynchos serves multiple experimental applications in mitochondrial and comparative biology research:

• Structural studies: As a component for 3D structural analysis of complex I, particularly in comparative studies between avian species such as those conducted between Anas platyrhynchos and Anas poecilorhyncha

• Functional assays: For investigating electron transport chain activity, particularly in reconstitution experiments measuring NADH dehydrogenase activity

• Antibody production: As an immunogen for developing specific antibodies against MT-ND1 for Western blotting, immunoprecipitation, and immunohistochemistry

• Interaction studies: To identify binding partners and study the assembly of complex I components

• Evolutionary studies: For phylogenetic analysis between different Anas species and other avian taxa based on mitochondrial gene sequences and protein structures

• Mutation analysis: As a reference protein when studying the effects of specific mutations on protein function and stability

The basic experimental application documented in the literature is SDS-PAGE for quality control and analysis of protein expression .

How do mutations in MT-ND1 affect complex I assembly and function?

Mutations in MT-ND1 can profoundly impact complex I at multiple levels, disrupting its assembly, stability, and functional capacity. Research has revealed several key mechanisms:

• Disruption of subunit interactions: Mutations can disrupt the electrostatic forces between MT-ND1 and nuclear-coded subunits like NDUFA1, preventing proper assembly of the complex

• Protein stability reduction: Specific mutations (e.g., m.3946G>A/ND1 p.E214K) decrease MT-ND1 protein stability, leading to accelerated degradation and reduced complex I levels

• Assembly interference: Mutations like m.3571dupC above a threshold level (85-93%) result in complete loss of MT-ND1, preventing early assembly of complex I. Importantly, even small amounts of wild-type MT-ND1 ectopic expression can partially restore assembly

• Cascade effects on other subunits: When MT-ND1 mutations impair complex I assembly, they trigger degradation of other subunits. In m.3571dupC mutant cell lines, researchers observed both MT-ND1 deficiency and decreased steady-state levels of nuclear-encoded subunits

• Supercomplex disruption: Some mutations affect not only complex I but disrupt the formation of supercomplexes (CI+CIII₂+CIV and CI+CIII₂), impairing respiratory chain organization

The impact of mutations varies by position within the protein, with those affecting ubiquinone binding domains or proton channels having particularly severe functional consequences.

What structural differences exist between MT-ND1 across avian species and what are their evolutionary implications?

Comparative structural analysis of MT-ND1 across avian species reveals both conservation and divergence with significant evolutionary implications:

• Structural conservation within genera: 3D structural analysis between Anas platyrhynchos and its close relative Anas poecilorhyncha reveals no detectable RMSD (root-mean-square deviation) differences, indicating high structural conservation within the Anas genus

• Divergence between taxonomic families: When comparing Anas platyrhynchos (duck) with Anser indicus (goose), significant structural differences emerge in several mitochondrial proteins, including:

  • ND2 (RMSD: 0.15)

  • Cox2 (RMSD: 0.55)

  • ND5 (RMSD: 0.44)

  • ND6 (RMSD: 2.68)

• Conserved regions across taxa: Despite differences between duck and goose, structural similarity was observed in several mitochondrial proteins: ND1, ND3, Cox1, ATP6, ATP8, Cox3, ND3, ND4, ND4L, and CytB

These structural analyses provide insights into evolutionary relationships and selective pressures on mitochondrial proteins in avian species. The conservation of MT-ND1 structure between duck species suggests functional constraints, while differences between duck and goose lineages reflect divergent evolution following their taxonomic split.

Phylogenetic analyses based on mitochondrial genes like cytochrome B have been used to establish evolutionary relationships among Anas species, with MT-ND1 serving as one of the informative markers for such studies .

How do specific MT-ND1 mutations contribute to pathophysiological mechanisms in mitochondrial diseases?

MT-ND1 mutations contribute to pathophysiological processes through multiple interconnected mechanisms that ultimately compromise cellular energy production and homeostasis:

• Disruption of early complex I assembly: Mutations interfere with the precise sequential assembly of complex I subunits, preventing formation of functional complexes and leading to energy deficiency

• Impairment of ubiquinone binding: MT-ND1 contributes to the ubiquinone binding domain of complex I. Mutations affecting this region directly impact electron transfer from NADH to ubiquinone, reducing complex I activity

• Proton channel dysfunction: As MT-ND1 forms part of the proton channel structure, mutations can compromise proton pumping across the inner mitochondrial membrane, reducing the proton gradient necessary for ATP synthesis

• Long-range coupling disruption: MT-ND1 mutations can disrupt the long-range coupling mechanism between electron transfer and proton pumping, compromising energy transduction efficiency

• Oxidative stress induction: Dysfunctional complex I resulting from MT-ND1 mutations often leads to increased production of reactive oxygen species (ROS), causing oxidative damage to mitochondrial components and triggering further dysfunction

• Mitochondrial bioenergetic collapse: The combined effects of these mechanisms can lead to collapse of mitochondrial bioenergetics, triggering cell death pathways and tissue damage in affected organs

These pathophysiological mechanisms have been implicated in various human diseases including Leber's Hereditary Optic Neuropathy (LHON) and type 2 diabetes, as mentioned in the literature .

What are the optimal storage and handling procedures for recombinant MT-ND1 protein?

Proper storage and handling of recombinant MT-ND1 protein is critical for maintaining its structural integrity and functional activity. Based on manufacturer recommendations, the following protocols should be implemented:

• Initial processing:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Storage preparation:

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Prepare multiple small aliquots to minimize freeze-thaw cycles

• Storage conditions:

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C or preferably -80°C

  • The protein is typically provided in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Critical precautions:

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein stability

  • When thawing, maintain the protein on ice to minimize degradation

  • After reconstitution, use the protein promptly for experimental procedures

Following these handling procedures will help ensure experimental reproducibility and reliable results when working with recombinant MT-ND1 protein.

What techniques are most effective for studying MT-ND1 mutations and their functional impacts?

Multiple complementary techniques have proven effective for investigating MT-ND1 mutations and their functional consequences:

• Genetic analysis techniques:

  • PCR amplification and Sanger sequencing in both directions (forward and reverse)

  • Alignment to reference sequences (e.g., NCBI reference NC_012920.1)

  • Next-generation sequencing for whole mitochondrial genome analysis

  • Library preparation using paired-end sequencing libraries (e.g., NEBNext Ultra DNA Library Preparation Kit)

• Bioinformatic prediction tools:

  • American College of Medical Genetics and Genomics (ACMG) guidelines

  • PolyPhen-2 for predicting impact of amino acid substitutions on protein structure/function

  • BioEdit sequence alignment editor for sequence analysis

• Structural analysis methods:

  • 3D structure prediction and comparison

  • RMSD calculation between wild-type and mutant proteins or between species

  • Analysis of ubiquinone binding domains and proton channels

• Functional assays:

  • Complex I enzyme activity measurements

  • Respiration studies in intact cells and isolated mitochondria

  • Analysis of supercomplexes assembly by blue native PAGE

• Statistical analysis approaches:

  • Non-parametric tests (Kruskal-Wallis H test, Mann-Whitney U test)

  • Spearman's correlation for measuring association strength between variables

  • Odds ratio calculation with 95% confidence intervals

Research indicates that combining genetic, structural, and functional approaches provides the most comprehensive understanding of how MT-ND1 mutations impact mitochondrial function and contribute to disease phenotypes.

How can one design experiments to investigate the assembly of MT-ND1 into complex I?

Designing experiments to investigate MT-ND1 assembly into complex I requires a multifaceted approach targeting different aspects of the assembly process:

• Cell models and systems:

  • Establish cell lines with controlled MT-ND1 mutations (e.g., using cybrid technology)

  • Develop inducible expression systems for wild-type and mutant MT-ND1

  • Utilize knockout/knockdown systems followed by rescue experiments with ectopic MT-ND1 expression

• Assembly intermediate characterization:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to separate assembly intermediates

  • Immunoprecipitation with antibodies against MT-ND1 or interacting subunits

  • Pulse-chase experiments to track the kinetics of complex I assembly

• Protein-protein interaction studies:

  • Proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of MT-ND1

  • Co-immunoprecipitation to identify direct binding partners

  • Crosslinking mass spectrometry to map interaction surfaces

• Structural visualization:

  • Cryo-electron microscopy of assembly intermediates

  • Super-resolution microscopy to track assembly in living cells

  • Fluorescence resonance energy transfer (FRET) between MT-ND1 and other subunits

• Functional correlation:

  • Measure complex I activity at different stages of assembly

  • Assess electron transfer and proton pumping in assembly intermediates

  • Correlate structural assembly with functional readouts

Research has shown that mutations in MT-ND1 can specifically interfere with early assembly steps of complex I, making this protein a critical target for understanding the entire assembly process . Experimental designs should focus on capturing these early stages and identifying the sequential incorporation of other subunits.

How can MT-ND1 research contribute to understanding mitochondrial disease mechanisms?

MT-ND1 research offers several avenues for advancing our understanding of mitochondrial disease mechanisms:

• Disease mutation cataloging and characterization:

  • Comprehensive analysis of MT-ND1 mutations in patient populations

  • Correlation between specific mutations and clinical phenotypes

  • Threshold determination for heteroplasmy levels required for disease manifestation

• Structure-function relationships:

  • Detailed understanding of how MT-ND1 contributes to complex I architecture

  • Mapping of disease mutations to functional domains (ubiquinone binding sites, proton channels)

  • Elucidation of coupling mechanisms between electron transfer and proton pumping

• Pathophysiological pathway identification:

  • Characterization of downstream effects of MT-ND1 dysfunction

  • Identification of compensatory mechanisms in response to complex I deficiency

  • Exploration of tissue-specific vulnerability to MT-ND1 mutations

• Therapeutic target development:

  • Identification of sites for potential pharmacological intervention

  • Development of strategies to enhance assembly or stability of mutant complex I

  • Testing approaches to bypass complex I deficiency through alternative metabolic pathways

MT-ND1 mutations have been associated with Leber's Hereditary Optic Neuropathy (LHON) and type 2 diabetes, among other conditions. Understanding the specific mechanisms by which these mutations lead to disease can provide insights applicable to other mitochondrial disorders and inform therapeutic approaches .

What are the comparative evolutionary insights from studying MT-ND1 across different avian species?

Studying MT-ND1 across avian species offers valuable evolutionary insights:

• Phylogenetic relationship clarification:

  • MT-ND1 sequence and structure comparison helps reconstruct evolutionary relationships

  • Identification of conserved regions suggests functional constraints

  • Detection of variable regions indicates potential adaptation to specific ecological niches

• Selection pressure analysis:

  • Comparison of non-synonymous to synonymous substitution rates (dN/dS) can identify regions under positive or purifying selection

  • Correlation of selection patterns with functional domains in the protein

• Structural conservation patterns:

  • 3D structural analysis reveals conservation within genera (e.g., no RMSD difference between Anas platyrhynchos and Anas poecilorhyncha)

  • Significant structural differences between more distant taxa (e.g., between Anas platyrhynchos and Anser indicus)

• Functional adaptation signatures:

  • Identification of lineage-specific adaptations in mitochondrial proteins

  • Correlation of molecular changes with physiological adaptations (e.g., flight capabilities, metabolic rates)

Research has demonstrated that mitochondrial genes, including MT-ND1, are effective for discriminating between duck species, making them valuable for genetic conservation programs for both wild and domestic duck breeds . Additionally, these comparative studies can provide insights into the molecular basis of adaptation to different environments.

What methodological advances could improve MT-ND1 functional characterization?

Several methodological advances could significantly enhance MT-ND1 functional characterization:

• Advanced structural biology techniques:

  • High-resolution cryo-electron microscopy of complex I with specific focus on MT-ND1

  • Time-resolved structural studies to capture dynamic conformational changes

  • Neutron scattering techniques to map proton pathways in the protein

• Single-molecule functional assays:

  • Development of assays to measure electron transfer and proton pumping at the single-molecule level

  • Correlation of structural dynamics with functional outputs

  • Real-time monitoring of complex I assembly incorporating MT-ND1

• In situ visualization approaches:

  • CRISPR-based tagging of MT-ND1 for live-cell imaging

  • Super-resolution microscopy to track assembly and localization within mitochondria

  • Correlative light and electron microscopy to connect functional states with ultrastructure

• Improved heterologous expression systems:

  • Development of eukaryotic cell-free systems for MT-ND1 expression

  • Optimization of membrane protein reconstitution for functional studies

  • Creation of artificial membrane systems mimicking the mitochondrial inner membrane

• Advanced genetic models:

  • CRISPR/Cas9 mitochondrial genome editing for precise mutation introduction

  • Development of animal models with specific MT-ND1 mutations

  • Patient-derived organoids to study tissue-specific effects of MT-ND1 mutations

These methodological advances would address current limitations in understanding the precise roles of MT-ND1 in complex I assembly, electron transfer, and proton pumping, potentially leading to breakthroughs in comprehending mitochondrial disease mechanisms.