Recombinant Aneura mirabilis Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Aneura mirabilis Photosystem Q(B) Protein

Recombinant Aneura mirabilis Photosystem Q(B) protein refers to the engineered version of the Photosystem II (PSII) D1 protein (PsbA) from the parasitic liverwort Aneura mirabilis. This protein is critical for light-driven electron transport in PSII, though Aneura mirabilis itself has lost most photosynthetic functionality due to its parasitic lifestyle . The recombinant form is expressed in E. coli with an N-terminal His tag for purification and structural/functional studies .

Functional Significance in Photosynthesis

The D1 protein (PsbA) is central to PSII’s light-dependent reactions:

  1. Electron Transfer: The Q(B) site binds plastoquinone (PQ), enabling sequential oxidation of water and reduction of PQ .

  2. Protein Stability: Interactions with assembly factors (e.g., CtpA, CPRabA5e) ensure proper C-terminal processing and integration into PSII complexes .

  3. Herbicide Target: The Q(B) pocket is a binding site for PSII-inhibiting herbicides like terbutryn, which block electron transfer .

Production Parameters

ParameterDetail
Expression SystemE. coli with plasmid-based expression
PurificationHis-tag affinity chromatography
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50%)

Research Applications

  • Structural Biology: Studying PSII supercomplex assembly and quinone binding dynamics .

  • Evolutionary Studies: Investigating gene loss in parasitic plants (e.g., Aneura mirabilis) .

  • Drug Development: Testing herbicide interactions with conserved Q(B) residues .

Key Discoveries

  1. Conservation of Q(B) Site: Structural studies of cyanobacterial PSII reveal high conservation of Q(B) residues (e.g., His215, Ser264) across oxygenic phototrophs, including A. mirabilis .

  2. Assembly Dependencies: Proteases like CtpA2 are essential for D1 C-terminal processing, a step critical for PSII maturation .

  3. Parasitism and Gene Loss: Aneura mirabilis retains psbA but has lost other photosynthetic genes (e.g., petA, petB), highlighting relaxed selection on non-essential PSII components .

Emerging Questions

  • How does the recombinant D1 protein from A. mirabilis differ functionally from active PSII proteins in phototrophs?

  • What structural insights into Q(B) binding can be derived from comparative studies of A. mirabilis and Prorocentrum micans PsbA?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Aneura mirabilis (Parasitic liverwort) (Cryptothallus mirabilis)
Target Names
psbA
Target Protein Sequence
MTATLERRESASIWGRFCDWVTSTENRLYIGWFGVLMIPTLLAATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYLAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVAGIWFTASGISTMAFNLNGF NFNQSVVDSQGRVINTWAGIINRANLGMEVMHERNAHKFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.