Recombinant Angiopteris evecta Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-318
Protein Length
Full Length of Mature Protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAIVKIPYDMQVKQV LANGKKGGLNVGAVPILPQGFELAPSDRIPTEIKEKIGNLSFQNYSPDKKNIIIVGPVPG KKYSEIVFPILSPDPASNKESNFLKYPIYVGGNRGRGQIYPDGSRSNNTVYNASATGKVI KIFRKEKKGGYEITIEKTSDGRQVVDIVPPGPELIISEGEFLKVDQPLTNNPNVGGFGQG DAEIVLQDPLRIQGLLLFFASVVLAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and why is it significant in Angiopteris evecta studies?

Apocytochrome f is a protein encoded by the petA gene found in the chloroplast genome of photosynthetic organisms, including the fern Angiopteris evecta. It serves as a crucial component of the cytochrome b6f complex, which facilitates electron transfer during photosynthesis between photosystem II and photosystem I . The significance of studying this protein in A. evecta specifically stems from its evolutionary importance, as Angiopteris represents a major lineage (marattioid ferns) that diverged early in fern evolution . Understanding the structure and function of this protein contributes to our knowledge of photosynthetic processes and chloroplast genome evolution across plant lineages.

What are the optimal expression systems for producing functional recombinant Angiopteris evecta Apocytochrome f?

The selection of an expression system for recombinant Angiopteris evecta Apocytochrome f production depends on research objectives, focusing on either high yield or functional authenticity :

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHighest yield, shortest production time, cost-effective, well-established protocolsLimited post-translational modifications, potential for inclusion body formationStructural studies, antibody production, interactions requiring only primary structure
YeastGood yield, eukaryotic post-translational modifications, secretion capacityMore complex than bacterial systems, some glycosylation patterns differ from plantsFunctional studies requiring basic eukaryotic modifications
Insect cells (Baculovirus)More complex post-translational modifications, better protein foldingLower yields, longer production time, higher costStudies requiring near-native protein conformation and activity
Mammalian cellsMost sophisticated post-translational modificationsLowest yields, highest cost, most complex protocolsResearch demanding authentic protein activity and complex modifications

How does RNA editing impact the expression and function of recombinant Apocytochrome f in heterologous systems?

RNA editing, a process where plant organelles modify RNA sequences after transcription, significantly impacts the expression and function of recombinant Apocytochrome f in heterologous systems . This phenomenon presents several challenges for researchers:

  • Sequence discrepancies: The protein sequence derived from genomic DNA may differ from the native protein due to C-to-U editing events, potentially altering start/stop codons and amino acid identity .

  • Functional implications: Unedited transcripts may produce proteins with altered structure and reduced function, particularly affecting:

    • Cofactor binding efficiency (heme attachment)

    • Electron transfer capabilities

    • Protein-protein interactions within the cytochrome b6f complex

    • Membrane insertion and topology

  • Expression system limitations: Most heterologous expression systems (E. coli, yeast) lack the RNA editing machinery present in plant chloroplasts .

To address these challenges, researchers should:

  • Compare genomic and cDNA sequences to identify potential editing sites

  • Consider using the edited cDNA sequence for recombinant expression

  • When using genomic DNA, introduce site-directed mutations to mimic editing events

  • Validate protein function through electron transport assays comparing native and recombinant proteins

Understanding RNA editing sites in the petA transcript is essential for producing functionally authentic recombinant protein, particularly when the research focuses on electron transport activity rather than merely structural studies .

What evolutionary insights can be gained from comparing Apocytochrome f across fern lineages versus other plant groups?

Comparative analysis of Apocytochrome f across fern lineages and other plant groups offers valuable evolutionary insights:

These evolutionary comparisons enhance our understanding of both photosynthetic apparatus evolution and the broader patterns of plant phylogeny, positioning Angiopteris evecta as a key taxon for investigating the early evolution of ferns and their photosynthetic machinery .

What are the recommended protocols for purification and storage of recombinant Angiopteris evecta Apocytochrome f?

Effective purification and storage of recombinant Angiopteris evecta Apocytochrome f requires specific protocols to maintain protein integrity and function:

Purification Protocol:

  • Initial Extraction:

    • For E. coli expression systems: Lyse cells using sonication or French press in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and protease inhibitors

    • For eukaryotic systems: Use appropriate cell disruption methods with similar buffer compositions

  • Affinity Chromatography:

    • If tagged protein: Use appropriate affinity resin (Ni-NTA for His-tagged proteins)

    • For untagged protein: Consider ion-exchange chromatography based on the protein's predicted isoelectric point

  • Secondary Purification:

    • Size exclusion chromatography using a column equilibrated with storage buffer

    • Consider additional ion-exchange steps if higher purity is required

  • Buffer Exchange:

    • Dialyze or use desalting columns to exchange into final storage buffer (Tris-based buffer with 50% glycerol)

Storage Recommendations:

  • Short-term Storage (1 week):

    • Store working aliquots at 4°C in Tris-based buffer optimized for protein stability

  • Long-term Storage:

    • Store at -20°C for routine storage

    • For extended preservation, store at -80°C

    • Include 50% glycerol in storage buffer to prevent freeze-thaw damage

  • Critical Precautions:

    • Avoid repeated freezing and thawing which can lead to protein denaturation and loss of activity

    • Prepare small working aliquots to minimize freeze-thaw cycles

    • Consider adding reducing agents (e.g., DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

This optimized protocol balances the need for high purity with maintaining the protein's structural integrity and functional activity, essential for downstream experimental applications.

How can researchers effectively design experiments to study the electron transfer function of recombinant Apocytochrome f?

Designing rigorous experiments to study the electron transfer function of recombinant Apocytochrome f requires multiple complementary approaches:

Spectroscopic Analysis:

  • UV-Visible Spectroscopy:

    • Monitor absorption spectra between 250-700 nm to verify heme incorporation

    • Observe characteristic peaks at ~420 nm (Soret band) and ~550 nm (α-band)

    • Compare reduced (with sodium dithionite) and oxidized forms to confirm redox activity

  • Circular Dichroism (CD):

    • Verify secondary structure integrity compared to native protein

    • Assess thermal stability through temperature-dependent CD measurements

Functional Assays:

  • Electron Transfer Kinetics:

    • Measure electron transfer rates using stopped-flow spectroscopy

    • Utilize artificial electron donors and acceptors to isolate Apocytochrome f function

    • Compare kinetic parameters (kcat, Km) between recombinant and native proteins

  • Reconstitution Experiments:

    • Incorporate recombinant Apocytochrome f into liposomes or nanodiscs

    • Measure proton gradient formation using pH-sensitive fluorescent dyes

    • Assess electron transport chain functionality in the reconstituted system

Structural Verification:

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Verify oligomeric state and structural integrity

    • Assess protein-protein interactions with partner proteins

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map solvent accessibility and conformational dynamics

    • Identify regions involved in electron transfer

Mutagenesis Studies:

  • Site-Directed Mutagenesis:

    • Generate variants with mutations at key residues (particularly the CXXCH motif)

    • Compare electron transfer efficiency of mutants to wild-type protein

    • Create a structure-function relationship map for critical residues

These methodological approaches provide a comprehensive experimental framework for characterizing the electron transfer function of recombinant Apocytochrome f, enabling researchers to understand its role in photosynthetic electron transport with implications for both basic science and potential biotechnological applications.

What techniques can be used to investigate the integration of recombinant Apocytochrome f into thylakoid membranes?

Investigating the integration of recombinant Apocytochrome f into thylakoid membranes requires specialized techniques spanning from in vitro reconstitution to in vivo validation:

In Vitro Membrane Reconstitution:

  • Liposome Incorporation:

    • Prepare liposomes mimicking thylakoid lipid composition

    • Monitor protein incorporation using fluorescently labeled Apocytochrome f

    • Assess orientation using protease protection assays to verify correct topology

  • Nanodiscs Technology:

    • Encapsulate Apocytochrome f in nanodiscs with defined lipid composition

    • Utilize native-PAGE to confirm successful incorporation

    • Employ transmission electron microscopy (TEM) to visualize membrane integration

Biophysical Characterization:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label Apocytochrome f and potential interaction partners with appropriate fluorophores

    • Measure FRET efficiency to determine proximity and orientation within the membrane

    • Use time-resolved FRET to detect dynamic interactions

  • Atomic Force Microscopy (AFM):

    • Visualize topography of Apocytochrome f in reconstituted membranes

    • Measure interaction forces between Apocytochrome f and other thylakoid components

    • Map protein distribution patterns within the membrane landscape

In Vivo Assessment:

  • Chloroplast Transformation:

    • Introduce tagged versions of Apocytochrome f through chloroplast transformation

    • Assess functionality through complementation of mutant phenotypes

    • Analyze electron transport chain efficiency in transformed lines

  • Confocal Microscopy:

    • Visualize localization using fluorescently tagged Apocytochrome f

    • Perform colocalization studies with other thylakoid components

    • Employ fluorescence recovery after photobleaching (FRAP) to measure lateral mobility

Functional Validation:

  • Electron Transport Measurements:

    • Measure oxygen evolution rates in reconstituted systems

    • Use Clark-type electrodes to assess electron transport capacity

    • Compare quantum efficiency of photosystem II in systems with native versus recombinant protein

  • Cross-linking Studies:

    • Identify interaction partners through chemical cross-linking coupled with mass spectrometry

    • Map the interactome of Apocytochrome f within the thylakoid membrane

    • Validate structural predictions about membrane topology and protein-protein interfaces

These methodological approaches provide researchers with a comprehensive toolkit for investigating how recombinant Apocytochrome f integrates into thylakoid membranes, essential knowledge for understanding both fundamental aspects of photosynthetic machinery assembly and potential applications in synthetic biology .

How can researchers address issues of protein misfolding when expressing Angiopteris evecta Apocytochrome f in heterologous systems?

Protein misfolding is a common challenge when expressing Angiopteris evecta Apocytochrome f in heterologous systems, requiring systematic troubleshooting approaches:

Causes and Solutions for Misfolding:

Common IssuePotential CausesRecommended Solutions
Inclusion body formation in E. coliHigh expression rates, lack of chaperones, absence of post-translational modifications- Reduce expression temperature (16-20°C)
- Use weaker promoters (T7-lac instead of T7)
- Co-express with chloroplast-specific chaperones
- Add solubility tags (MBP, SUMO, Trx)
Improper heme incorporationInsufficient heme availability, oxidative environment- Supplement growth media with δ-aminolevulinic acid
- Add hemin to culture
- Include reducing agents in lysis buffer
- Express in E. coli strains optimized for heme proteins
Incorrect disulfide bond formationReducing cytoplasmic environment in E. coli- Use E. coli strains with oxidizing cytoplasm (Origami, SHuffle)
- Direct protein to periplasm using appropriate signal sequences
- Consider eukaryotic expression systems
Membrane protein aggregationHydrophobic transmembrane domains- Use specialized detergents during extraction (DDM, LDAO)
- Optimize detergent:protein ratio
- Consider membrane-mimetic systems for purification

Refolding Strategies:

  • On-column Refolding:

    • Immobilize denatured protein on affinity resin

    • Gradually remove denaturant through decreasing concentration gradient

    • Supplement refolding buffer with appropriate cofactors (heme)

  • Dialysis-based Refolding:

    • Solubilize inclusion bodies in 8M urea or 6M guanidine-HCl

    • Dialyze stepwise against decreasing denaturant concentrations

    • Include redox pairs (GSH/GSSG) to facilitate disulfide formation

  • Expression System Selection:

    • Consider insect cell or mammalian expression systems for complex proteins requiring extensive post-translational modifications

    • Evaluate chloroplast-specific expression systems that provide the native folding environment

  • Structural Validation:

    • Verify proper folding using circular dichroism to assess secondary structure

    • Confirm heme incorporation through UV-visible spectroscopy

    • Test functionality through electron transfer assays

These strategies provide a comprehensive approach to addressing protein misfolding challenges, enabling researchers to obtain correctly folded recombinant Angiopteris evecta Apocytochrome f for structural and functional studies .

What strategies can overcome low yields when producing recombinant Angiopteris evecta Apocytochrome f?

Researchers frequently encounter yield challenges when producing recombinant Angiopteris evecta Apocytochrome f. The following comprehensive strategies can help overcome these limitations:

Expression System Optimization:

  • E. coli Enhancement Strategies:

    • Evaluate multiple E. coli strains (BL21(DE3), C41/C43, Rosetta for rare codons)

    • Optimize codon usage for E. coli preference while maintaining critical functional regions

    • Test varied induction conditions (IPTG concentration, induction timing, temperature)

    • Consider auto-induction media for gradual protein expression

  • Alternative Expression Systems:

    • For difficult-to-express constructs, transition to yeast systems (P. pastoris, S. cerevisiae)

    • For complex folding requirements, utilize insect cell expression systems

    • Implement cell-free protein synthesis systems for toxic proteins

Genetic Construct Engineering:

  • Fusion Partners:

    • Incorporate solubility-enhancing tags (MBP, SUMO, Trx, GST)

    • Include purification tags strategically positioned to minimize functional interference

    • Test multiple tag positions (N-terminal vs. C-terminal) to determine optimal configuration

  • Expression Vector Selection:

    • Evaluate promoter strength (T7 vs. tac vs. arabinose-inducible)

    • Test different origins of replication for copy number optimization

    • Consider dual-promoter systems for balanced expression

Growth and Induction Optimization:

  • Culture Conditions:

    • Implement fed-batch cultivation to reach higher cell densities

    • Optimize media composition (rich vs. defined media)

    • Control dissolved oxygen levels in fermentation systems

  • Induction Parameters:

    • Perform temperature shift experiments (37°C growth, 16-20°C induction)

    • Test extended expression times at lower temperatures

    • Evaluate continuous vs. pulse feeding strategies in bioreactor systems

Protective Strategies:

  • Stabilization Approaches:

    • Add protease inhibitor cocktails during extraction

    • Include stabilizing agents (glycerol, arginine, trehalose) in buffers

    • Optimize pH and ionic strength based on theoretical isoelectric point

  • Chaperone Co-expression:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Include chloroplast-specific chaperones when possible

    • Test chemical chaperones in growth media (betaine, sorbitol)

These systematic optimization strategies can significantly improve recombinant Apocytochrome f yields, enabling sufficient production for downstream structural and functional characterization while maintaining protein quality and activity .

How can researchers validate the structural and functional authenticity of recombinant Angiopteris evecta Apocytochrome f?

Validating the structural and functional authenticity of recombinant Angiopteris evecta Apocytochrome f requires a multi-faceted approach combining biophysical, biochemical, and functional assessments:

Structural Validation Methods:

  • Primary Structure Verification:

    • Perform mass spectrometry to confirm molecular weight

    • Conduct N-terminal sequencing to verify correct processing

    • Map post-translational modifications using tandem MS/MS

    • Verify heme incorporation through absorption spectroscopy (characteristic peaks at ~420 nm and ~550 nm)

  • Secondary and Tertiary Structure Analysis:

    • Compare circular dichroism (CD) spectra between recombinant and native proteins

    • Conduct thermal stability assays to determine melting temperature (Tm)

    • Perform limited proteolysis to assess domain folding

    • When feasible, utilize X-ray crystallography or cryo-EM for high-resolution structural comparison

Functional Authentication:

  • Electron Transfer Capability:

    • Measure redox potential using cyclic voltammetry or potentiometric titrations

    • Compare midpoint potentials between recombinant and native proteins

    • Assess electron transfer rates using stopped-flow spectroscopy

    • Develop reconstituted systems to test electron flow between physiological partners

  • Protein-Protein Interaction Assays:

    • Conduct pull-down assays with known interaction partners

    • Perform surface plasmon resonance (SPR) to determine binding kinetics

    • Utilize microscale thermophoresis to measure binding affinities

    • Implement FRET-based assays for detecting dynamic interactions

Comparative Analysis Framework:

ParameterTechniqueAcceptance CriteriaReference Standard
Molecular MassESI-MS or MALDI-TOF≤0.1% deviation from theoreticalCalculated from sequence
Secondary StructureCircular DichroismSpectral overlay with ≥90% similarityNative protein or homologous protein
Heme IncorporationUV-Vis SpectroscopyCharacteristic Soret band at 420±5 nmPublished spectra
Redox PotentialCyclic VoltammetryWithin ±20 mV of native proteinLiterature values
Thermal StabilityDifferential Scanning CalorimetryTm within ±5°C of native proteinNative protein
Electron Transfer RateStopped-flow Spectroscopy≥80% of native protein activityNative protein or reconstituted system

Integration Testing:

  • Reconstitution Experiments:

    • Incorporate protein into liposomes mimicking thylakoid composition

    • Measure proton gradient formation using pH-sensitive fluorescent dyes

    • Assess functionality in membrane environment

  • In vivo Complementation:

    • Test ability to rescue mutant phenotypes in model organisms

    • Measure photosynthetic efficiency parameters after complementation

    • Compare growth rates under various light conditions

How can recombinant Angiopteris evecta Apocytochrome f contribute to understanding evolutionary adaptations in photosynthesis?

Recombinant Angiopteris evecta Apocytochrome f serves as a powerful tool for elucidating evolutionary adaptations in photosynthesis, providing insights across multiple research dimensions:

Evolutionary Trajectory Analysis:

Angiopteris evecta represents a critical evolutionary position as part of the marattioid ferns, a major lineage that diverged early in fern evolution . By studying its recombinant Apocytochrome f:

  • Researchers can trace the molecular evolution of electron transport components by comparing sequence and structural features with those from other evolutionary lineages (bryophytes, lycophytes, seed plants)

  • Functional differences between recombinant Apocytochrome f proteins from diverse photosynthetic organisms can reveal adaptive changes that accompanied land plant diversification

  • Comparative analysis of electron transfer efficiency can illuminate how photosynthetic machinery evolved to accommodate different environmental conditions

Structure-Function Relationship Mapping:

  • Site-directed mutagenesis of conserved versus variable residues can identify regions under different selective pressures

  • Chimeric proteins combining domains from different evolutionary lineages can pinpoint functional adaptations

  • Structural comparisons reveal how subtle sequence variations translate to functional differences in electron transport efficiency

Genomic Context Integration:

The petA gene exists within the 153,901 bp plastid genome of Angiopteris evecta, which includes inverted repeats (IRA and IRB) of 21,053 bp each, a large single-copy region of 89,709 bp, and a small single-copy region of 22,086 bp . This genomic context provides:

  • Insights into the co-evolution of photosynthetic proteins with other chloroplast-encoded components

  • Understanding of how gene arrangement and expression regulation evolved in different plant lineages

  • Clues about the selective pressures that maintained certain genes in the chloroplast genome rather than transferring to the nucleus

Adaptive Radiation Investigation:

  • Correlating structural and functional properties of Apocytochrome f with ecological adaptations across fern lineages

  • Investigating how variations in electron transport components contributed to the success of different plant groups in various ecological niches

  • Exploring the molecular basis for adaptations to different light environments

This research has profound implications for understanding photosynthetic evolution and potentially informing strategies for engineering improved photosynthetic efficiency in crops, contributing to both fundamental evolutionary biology and applied agricultural research .

What potential exists for using Angiopteris evecta as a model system for chloroplast genetic engineering?

Angiopteris evecta offers unique advantages as a model system for chloroplast genetic engineering, presenting both opportunities and challenges for researchers:

Evolutionary Significance and Genetic Resources:

Angiopteris evecta, as a member of the marattioid ferns, occupies a phylogenetically informative position in plant evolution . The availability of its complete plastid genome sequence (153,901 bp) provides:

  • A comprehensive genetic roadmap for targeting transgene insertion

  • Identification of promoters, terminators, and regulatory elements for expression construct design

  • Understanding of gene arrangement and potential insertion sites that minimize disruption of essential functions

  • Comparative context for chloroplast engineering across evolutionary lineages

Technical Advantages for Chloroplast Transformation:

  • The large size of A. evecta cells and chloroplasts could facilitate microinjection or biolistic transformation

  • The fern gametophyte stage provides a haploid system that simplifies genetic analysis

  • The distinctive reproductive biology offers unique opportunities for selection and regeneration of transformants

  • The long-lived nature of the sporophyte allows extended assessment of transgene stability

Research Applications and Potential:

ApplicationAdvantage in AngiopterisResearch Potential
Photosynthesis ResearchEarly-diverging lineage provides evolutionary contextInvestigate ancestral states of photosynthetic machinery
Transplastomic ExpressionUnique promoter elements may drive high expressionNovel expression tools for chloroplast engineering
RNA Editing StudiesPlant organelles exhibit RNA editing Platform for understanding editing machinery evolution
Bioproduct ManufacturingPerennial growth habitSustainable production system
Evolutionary BiologyPhylogenetically informative positionBridge between bryophytes and seed plants

Methodological Considerations:

Several approaches could be developed for Angiopteris evecta chloroplast transformation:

  • Biolistic Transformation:

    • Optimize parameters for particle bombardment of fern tissues

    • Develop selection markers suitable for fern chloroplasts

    • Design homologous recombination constructs based on the sequenced genome

  • Protoplast-based Methods:

    • Establish protocols for isolation and culture of viable protoplasts

    • Adapt PEG-mediated or electroporation techniques for chloroplast transformation

    • Develop regeneration systems from transformed protoplasts

  • Alternative Approaches:

    • Explore CRISPR-based technologies for targeted chloroplast genome editing

    • Investigate cell-penetrating peptides for DNA delivery to chloroplasts

    • Consider microinjection techniques leveraging the large cell size

This research direction would establish Angiopteris evecta as a valuable complementary model system for chloroplast engineering, offering unique perspectives distinct from current models like tobacco and Chlamydomonas, with implications for both fundamental science and biotechnological applications .

How might artificial intelligence and computational modeling advance research on recombinant Apocytochrome f structure and function?

Artificial intelligence and computational modeling are transforming research on proteins like recombinant Angiopteris evecta Apocytochrome f, offering powerful new approaches to understand structure, function, and evolution:

Advanced Structural Prediction and Analysis:

  • AI-Driven Structure Prediction:

    • AlphaFold2 and RoseTTAFold can generate highly accurate structural models of Apocytochrome f without experimental crystal structures

    • Comparative modeling against homologous structures can be enhanced with deep learning approaches

    • Prediction of flexible regions and conformational changes during electron transfer

  • Molecular Dynamics Simulations:

    • Simulate electron transfer pathways with quantum mechanics/molecular mechanics (QM/MM) approaches

    • Model protein-protein interactions within the cytochrome b6f complex

    • Investigate membrane integration and lipid interactions in the thylakoid environment

Functional Insights Through Computational Biology:

  • Network Analysis:

    • Map evolutionary conservation networks to identify functionally critical residues

    • Analyze coevolution patterns to predict interaction interfaces

    • Construct electron flow models within the photosynthetic apparatus

  • Quantum Biology Applications:

    • Simulate quantum coherence effects in electron transfer

    • Model electronic coupling between cofactors

    • Investigate the quantum mechanical basis of electron tunneling efficiency

Evolutionary and Comparative Genomics:

  • Phylogenetic Analysis:

    • Reconstruct the evolutionary history of Apocytochrome f across plant lineages

    • Identify adaptive mutations through selection pressure analysis

    • Map functional adaptations to environmental niches

  • Ancestral Sequence Reconstruction:

    • Infer ancestral Apocytochrome f sequences at key evolutionary nodes

    • Experimentally test reconstructed proteins to understand functional evolution

    • Identify when key structural innovations emerged in photosynthetic organisms

Design and Engineering Applications:

  • Protein Engineering:

    • Computational design of Apocytochrome f variants with enhanced electron transfer properties

    • In silico screening of mutations before experimental validation

    • Optimization of stability and folding in heterologous expression systems

  • Synthetic Biology:

    • Design of minimal artificial photosynthetic units incorporating optimized Apocytochrome f

    • Computational modeling of novel electron transport chains

    • Virtual prototyping of enhanced photosynthetic systems

These computational approaches complement traditional experimental methods, accelerating research progress and enabling insights that would be difficult to obtain through experimental approaches alone. The integration of AI with experimental validation creates a powerful research paradigm for understanding complex proteins like Apocytochrome f at multiple scales, from atomic-level interactions to evolutionary patterns across geological time .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.