Recombinant Angiopteris evecta ATP synthase subunit b, chloroplastic (atpF)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
atpF
Target Protein Sequence
MIHLNILYWPPAGGFGLNTNILEINIINLAVVLGVLIYLGKGVCAGCILNDLLENRKQTI
LSTIHDAEERYEEATEKLNQARTRLQQAKVKADEIRVNGLTQMEREKQDLINAADEDSRR
LEDSKNSTIRFEEQRAIEQVRQQVSRLALERALESLNTRLNNELHSRMIDYHIGLLRAME
STTDQFL
Uniprot No.
Target Background
Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembrane catalytic core, and the F(0) domain, housing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, through a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
