Recombinant Angiopteris evecta Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Chloroplast Genome of Angiopteris evecta and cemA Localization

The plastid genome of Angiopteris evecta (marattioid fern) is circular, spanning 153,901 bp, with a quadripartite structure comprising two inverted repeats (IRs: 21,053 bp each), a large single-copy (LSC: 89,709 bp), and a small single-copy (SSC: 22,086 bp) region . Annotation using DOGMA and BLAST homology searches identified cemA as part of the chloroplast genome .

  • Gene Order: The cemA gene resides in the LSC region, downstream of rpoB and upstream of psbZ, following an ancestral monilophyte gene arrangement shared with Psilotum nudum .

  • Functional Role: In plants, cemA facilitates chloroplast envelope membrane integrity and ion transport, though its specific role in A. evecta remains uncharacterized experimentally .

Absence of Direct Data on Recombinant cemA from A. evecta

No peer-reviewed studies in the provided sources describe the cloning, expression, or purification of recombinant cemA from A. evecta. Key gaps include:

  • Sequence Data: While the plastid genome sequence is published , no cDNA or protein sequences for cemA from A. evecta are explicitly provided.

  • Heterologous Expression: No reports detail recombinant expression systems (e.g., E. coli, yeast) for this protein.

  • Structural or Functional Studies: Biochemical properties, enzymatic activity, or structural models of cemA in A. evecta are unstudied .

Recombinant cemA in Oenothera parviflora

A recombinant cemA protein from Oenothera parviflora (evening primrose) is commercially available . While unrelated to A. evecta, its documentation provides a comparative framework:

PropertyDetails
Protein NameRecombinant Oenothera parviflora Chloroplast envelope membrane protein
SupplierCUSABIO TECHNOLOGY LLC (China)
Molecular WeightUnspecified (data absent in sources)
PreparationNo details on expression vector, host, or purification methods

Evolutionary Conservation of cemA

  • Land Plants: cemA is conserved across land plant plastid genomes, with sequence divergence reflecting lineage-specific adaptations .

  • IR Expansions: In A. evecta, the IR regions (21 kb) are larger than those of most non-seed plants (10–15 kb), potentially stabilizing cemA and other critical genes .

Research Recommendations

To advance understanding of recombinant A. evecta cemA, the following steps are proposed:

  1. cDNA Cloning: Isolate cemA transcripts from A. evecta chloroplasts using RNA-seq or RT-PCR.

  2. Expression Systems: Optimize heterologous expression in E. coli or chloroplast-transformation systems.

  3. Functional Assays: Characterize ion transport activity via electrophysiology or fluorescent dye assays.

Limitations and Data Gaps

  • No patents or publications directly address recombinant A. evecta cemA.

  • Commercial listings (e.g., ) reference unrelated species, highlighting potential taxonomic misattribution in databases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
cemA
Target Protein Sequence
MEFNNSVSTIYWSLLERKFSIYVLTFLNRLKCILSNPFSISFSNNKYPSFFNANKTFLKR DSCNLFPNQSNIMFFLVVLSKRLCPNYFNNTGEKKNRGDNINDSSGNRFIDESYVSARKS MSKESNKIKQMNRKLAWIEATLNDLDIWRHSYSVFSSSTKMENNLEQQFSVLESKDTPIT MMAYESISLVPRSITRTLSRFKTELMGDSNSLILNEFRLAKYQALASIQYIGCLLFILSI ISMLSKTMFLKSWITNWWNTSQSHIFLNLFQEERALKELQEMEELLWLDRVMADYVKDQS QDLDIEIYEETIQLVTIYNEDSIQIILHLLTDIISIVTLIVLFIIGRKRLAVLNSWIQEL FYSLSDTMKAFSILLLTDLCIGFHSPHGWEIVIGSFLEHLGFSHNKHIISCFVSTFPVIL DTVFKYWIFRHLNRISPSIVATYHTMNE
Uniprot No.

Target Background

Function
May be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Angiopteris evecta and what is its significance in botanical research?

Angiopteris evecta (G.Forst.) Hoffm. is a large fern species belonging to the Marattiaceae family. It holds significant importance in botanical research due to its primitive evolutionary status among ferns, its distinctive chloroplast genome characteristics, and its traditional medicinal applications. The species has been classified as Endangered (ER) according to IUCN RED plant guidelines, making its conservation a priority . Beyond its evolutionary significance, A. evecta contains bioactive compounds including angiopteroside (4-O-beta-D-Glucopyranosyl-L-thero-2-hexen-5-olide), which demonstrates pharmaceutical properties including antibacterial, antifungal, and antituberculosis activities . Its traditional uses in treating snake bites, spider stings, and various ailments highlight its ethnobotanical significance and potential for pharmacological research.

What is the chloroplast envelope membrane protein (cemA) and its general function in plants?

The chloroplast envelope membrane protein A (cemA) is encoded by the cemA gene in the chloroplast genome and plays a crucial role in carbon dioxide transport across chloroplast membranes. In photosynthetic organisms, cemA facilitates CO₂ uptake into chloroplasts, which is essential for the carbon fixation process. The protein is embedded in the chloroplast envelope membrane and functions as part of the carbon concentrating mechanism, particularly important in environments where CO₂ availability might be limited. In ferns like A. evecta, chloroplast genes including cemA are of particular interest because they represent evolutionary ancient photosynthetic mechanisms that have been conserved through millions of years of plant evolution .

What are the genomic characteristics of Angiopteris evecta chloroplast DNA?

Angiopteris evecta possesses a chloroplast genome of 153,901 base pairs with a GC content of 35.48% . The genome structure follows the typical quadripartite structure found in most land plants, consisting of a large single copy (LSC) region of 89,709 bp, a small single copy (SSC) region of 22,086 bp, and two inverted repeat (IR) regions each spanning 21,053 bp . The chloroplast genome of A. evecta contains 121 genes in total, including 85 protein-coding genes, 4 rRNA genes, and 32 tRNA genes . This gene composition distinguishes A. evecta from other fern species like Dryopteris fragrans (112 total genes) and Adiantum capillus-veneris (117 total genes), showing its unique evolutionary position. The complete chloroplast genome sequence provides valuable insights into the evolutionary history of ferns and serves as a foundation for studies on chloroplast proteins like cemA.

How does the cemA gene structure in Angiopteris evecta compare to other fern species?

The cemA gene in A. evecta, like in other ferns, is located in the large single copy (LSC) region of the chloroplast genome. When comparing the chloroplast genome structure of A. evecta with other fern species, several distinctions become apparent. A. evecta has a total of 121 genes in its chloroplast genome, which is higher than many other ferns such as Dryopteris fragrans (112 genes), Adiantum capillus-veneris (117 genes), and Onoclea sensibilis (112 genes) . This difference in gene number suggests potential variations in gene content and organization.

What challenges exist in expressing recombinant cemA from Angiopteris evecta?

Expressing recombinant cemA from A. evecta presents several significant challenges that researchers need to address:

First, codon optimization is essential due to the low GC content (35.48%) of A. evecta chloroplast genome compared to potential expression hosts . This difference in codon usage can significantly reduce expression efficiency in heterologous systems like E. coli or yeast, requiring careful codon optimization based on the target expression system.

Second, cemA is a membrane protein, which inherently complicates expression and purification protocols. Membrane proteins often misfold or form inclusion bodies when overexpressed, necessitating specialized solubilization and refolding techniques. Expression systems with robust membrane protein expression capabilities (like insect cells or specialized E. coli strains) might be required.

Third, preserving the functional structure of cemA during recombinant expression is challenging. The protein's native conformation depends on proper insertion into the chloroplast membrane, which may not be replicated in heterologous systems. Fusion tags that enhance solubility or aid in membrane targeting may be necessary but could interfere with function.

Finally, the endangered status of A. evecta limits access to source material, making initial gene cloning more difficult and emphasizing the need for conservation-conscious research approaches.

What experimental approaches can verify the functionality of recombinant cemA?

Verifying the functionality of recombinant cemA requires multiple complementary approaches:

Carbon dioxide transport assays provide the most direct assessment. These can be performed by reconstituting purified recombinant cemA into liposomes and measuring CO₂ movement across these artificial membranes. Radioisotope-labeled carbon dioxide (¹⁴CO₂) or carbonic anhydrase-coupled assays can quantify transport rates.

Complementation studies in model organisms offer another approach. Researchers can introduce A. evecta cemA into cemA-deficient mutants of model photosynthetic organisms (such as Chlamydomonas reinhardtii or Synechocystis sp.) and assess recovery of CO₂ uptake and photosynthetic efficiency.

Structural analysis using techniques like circular dichroism spectroscopy, fluorescence spectroscopy, or limited proteolysis can verify proper protein folding. More advanced structural determination via X-ray crystallography or cryo-electron microscopy, though challenging with membrane proteins, would provide definitive structural validation.

Binding assays with potential interaction partners can also provide functional evidence. Co-immunoprecipitation or surface plasmon resonance studies with proteins known to interact with cemA in other species can confirm functional protein conformation.

What is the optimal protocol for isolating and amplifying the cemA gene from Angiopteris evecta?

The optimal protocol for isolating and amplifying the cemA gene from A. evecta involves several critical steps:

For chloroplast DNA extraction, fresh young fronds (10-15g) should be harvested, surface-sterilized with 70% ethanol, and thoroughly washed with distilled water. The modified CTAB method with high salt concentration (2.0M NaCl) is recommended for high-quality cpDNA extraction from ferns. After grinding tissue in liquid nitrogen, incubate with CTAB buffer (2% CTAB, 100mM Tris-HCl pH 8.0, 2.0M NaCl, 20mM EDTA, 2% PVP-40, 0.5% β-mercaptoethanol) at 65°C for 60 minutes. Following chloroform:isoamyl alcohol (24:1) extraction, precipitate DNA with isopropanol and wash with 70% ethanol before resuspension in TE buffer.

For PCR amplification of the cemA gene, design primers based on conserved regions flanking cemA in fern chloroplast genomes. The current data from A. evecta's chloroplast genome can guide primer design . A touchdown PCR protocol is recommended: initial denaturation at 95°C for 5 minutes; 5 cycles of 95°C for 45 seconds, 58°C for 45 seconds (decreasing by 1°C each cycle), 72°C for 90 seconds; followed by 30 cycles of 95°C for 45 seconds, 53°C for 45 seconds, 72°C for 90 seconds; and a final extension at 72°C for 10 minutes.

For gene verification, sequence the PCR product using Sanger sequencing and compare with existing database sequences. The sequence should be analyzed for open reading frames and conserved domains characteristic of cemA.

What expression systems are most suitable for producing recombinant cemA protein?

Several expression systems offer distinct advantages for recombinant cemA production:

The yeast expression system (Pichia pastoris or Saccharomyces cerevisiae) offers a eukaryotic environment with proper protein folding machinery and can be scaled for larger production. For cemA expression, methanol-inducible promoters (AOX1 in P. pastoris) permit tight regulation, and the α-factor secretion signal facilitates processing. Incubation at 25-28°C after induction optimizes membrane protein expression.

Insect cell systems (Sf9 or High Five cells with baculovirus vectors) provide advanced eukaryotic processing with high expression levels for membrane proteins. The pFastBac vector with polyhedrin promoter and a C-terminal His-tag allows for controlled expression and simplified purification.

For each system, codon optimization based on A. evecta's unique chloroplast codon usage (as evidenced by its distinct GC content of 35.48%) is essential for optimal expression .

What purification strategies are most effective for recombinant cemA?

Purifying recombinant cemA requires specialized approaches for membrane proteins:

The initial solubilization step is critical. Screen multiple detergents including mild non-ionic detergents (DDM, LMNG), zwitterionic detergents (LDAO, Fos-Choline-12), and newer amphipols or SMALPs. Optimal detergent concentration should be determined empirically, typically starting at 1-2% for solubilization and reduced to 0.02-0.05% for purification buffers. Solubilization should proceed at 4°C for 1-2 hours with gentle rotation.

For affinity chromatography, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective with His-tagged cemA. The binding buffer should contain 20mM Tris-HCl pH 7.8, 300mM NaCl, 10% glycerol, 0.02% selected detergent, and 20mM imidazole. After washing with 50mM imidazole, elute with a gradient of 100-500mM imidazole.

Size exclusion chromatography serves as a crucial second purification step to remove aggregates and ensure monodispersity. Use Superdex 200 column with buffer containing 20mM HEPES pH 7.5, 150mM NaCl, 5% glycerol, and detergent below critical micelle concentration.

For functional verification, circular dichroism spectroscopy should be performed immediately after purification to confirm secondary structure integrity. Additionally, thermal shift assays can assess protein stability under various buffer conditions.

How can researchers analyze the structural characteristics of cemA?

Structural analysis of cemA can be approached through multiple complementary techniques:

Computational prediction methods provide initial structural insights. Transmembrane helix prediction algorithms (TMHMM, Phobius) can identify membrane-spanning regions. Homology modeling using related proteins with known structures and tools like I-TASSER or SWISS-MODEL can generate preliminary 3D models. These predictions should be validated with experimental data.

Biochemical characterization techniques including limited proteolysis can map exposed regions, while cross-linking mass spectrometry can identify spatial relationships between protein domains. Cysteine scanning mutagenesis followed by accessibility studies helps map the protein topology in membranes.

Spectroscopic methods provide medium-resolution structural information. Circular dichroism spectroscopy quantifies secondary structure content (α-helices, β-sheets). Fourier-transform infrared spectroscopy specifically excels at analyzing membrane proteins in lipid environments.

High-resolution structural determination remains challenging but potentially transformative. X-ray crystallography requires detergent screening and lipidic cubic phase crystallization attempts. Single-particle cryo-electron microscopy may be more suitable for membrane proteins but typically requires larger protein complexes for reliable reconstruction. Newer approaches like microcrystal electron diffraction (MicroED) show promise for smaller membrane proteins.

How does cemA function relate to Angiopteris evecta's adaptation to different environments?

The cemA protein likely plays a crucial role in A. evecta's adaptation to varying CO₂ levels in different habitats. As a large fern species found in tropical and subtropical regions, A. evecta faces fluctuating environmental conditions that impact photosynthetic efficiency. The cemA protein's function in CO₂ transport across chloroplast membranes would be particularly important in low CO₂ environments or during periods of high photosynthetic demand.

The endangered status of A. evecta suggests vulnerability to changing environmental conditions, potentially related to its specialized photosynthetic adaptations. Ancient fern lineages like Angiopteris developed their photosynthetic machinery in atmospheric conditions different from today's, with higher CO₂ concentrations during much of their evolutionary history. The study of cemA may provide insights into how these ancient lineages adjust to modern atmospheric conditions.

Comparative studies of cemA across populations of A. evecta from different habitats could reveal adaptive variations in the protein structure or expression patterns. Such adaptations might be reflected in synonymous or non-synonymous mutations in the cemA gene sequence, which could be detected through population genetics approaches and related to environmental parameters.

What are the comparative characteristics of cemA across fern chloroplast genomes?

The chloroplast genome organization in ferns shows both conservation and diversity, with A. evecta displaying distinctive features compared to other fern species. The table below highlights key comparative chloroplast genome characteristics across selected fern species:

SpeciesTotal Length (bp)GC content (%)Number of genesProtein genesrRNA genestRNA genes
Angiopteris evecta153,90135.4812185432
Adiantum capillus-veneris150,56842.0011784429
Alsophila spinulosa156,66140.4311785428
Dryopteris fragrans151,98743.1511282426
Osmundastrum cinnamomeum142,81240.2012184433
Psilotum nudum138,82936.0311881433

This comparison reveals that A. evecta has a relatively large chloroplast genome with the lowest GC content among the compared ferns . It also contains the highest number of genes (tied with O. cinnamomeum), including more protein-coding genes than most other ferns. These genomic characteristics may influence the expression and function of chloroplast genes including cemA.

What potential applications exist for recombinant cemA in research?

Recombinant cemA from A. evecta offers several promising research applications:

In photosynthesis enhancement research, recombinant cemA could be used to study carbon concentrating mechanisms in plants. By expressing A. evecta cemA in model plants or algae, researchers could potentially enhance CO₂ uptake efficiency, contributing to efforts aimed at improving photosynthetic productivity in crop plants.

For structural biology, cemA represents an opportunity to understand membrane protein evolution in ancient plant lineages. Comparing the structure and function of cemA from primitive ferns like A. evecta with those from angiosperms could provide insights into the evolution of photosynthetic machinery across plant lineages.

In biomedical research, the study of cemA alongside other bioactive components from A. evecta may yield insights relevant to the plant's traditional medicinal applications. Given that A. evecta has been used to treat snake bites and contains compounds with antimicrobial properties , understanding the full protein complement of the plant could contribute to the identification of novel bioactive molecules.

For conservation biology, developing molecular tools based on cemA and other chloroplast genes could aid in genetic monitoring of the endangered A. evecta populations , supporting conservation efforts through better understanding of genetic diversity within remaining populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.