Recombinant Angiopteris evecta NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
ndhC
Target Protein Sequence
MFLLPKYDSFWLFLLIASLIPVSAFSISKILAPVSQGPEKLTSYESGIEPMGDAWIQFQI RYYMFALVFVIFDVETVFLYPWAMSFKELGISAFIEALIFVLILIIGLIYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic from Angiopteris evecta?

NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a component of the chloroplast NDH complex that participates in electron transport chains. The protein is encoded by the ndhC gene in the chloroplast genome and functions as part of a multisubunit complex that catalyzes the transfer of electrons from NAD(P)H to plastoquinone in photosynthetic electron transport chains . This protein has a molecular weight of approximately 13,803 Da and consists of 120 amino acids .

The NDH complex in chloroplasts shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur centers, coupling the redox reaction to proton translocation and thus conserving redox energy in a proton gradient . While the immediate electron acceptor for the enzyme in this species is believed to be plastoquinone, the complex contributes to both photosynthetic processes and potentially chloroplast respiratory chains .

How is the ndhC gene conserved across plant species?

The ndhC gene shows remarkable conservation across evolutionary lineages, particularly within ferns. Comparative genomic analyses of chloroplast genomes demonstrate that the gene maintains high sequence similarity across multiple species . The conservation pattern supports the hypothesis that Marattiaceae represent "molecular living fossils" with relatively little genetic differentiation despite long evolutionary periods.

Studies comparing the complete chloroplast genome of Angiopteris yunnanensis (152,962 bp) with other Angiopteris species show that these genomes maintain a highly conserved quadripartite structure consisting of:

  • Large single copy (LSC) region: 89,717 bp

  • Small single copy (SSC) region: 20,585 bp

  • Two inverted repeat (IR) regions: 21,330 bp each

Phylogenetic analyses based on 53 coding genes reveal that Angiopteris species form a distinct clade, with remarkably short branch lengths indicating minimal genetic divergence. This conservation extends beyond Angiopteris to other genera within Marattiaceae, such as Christensenia, reinforcing the notion of structural conservatism in these ancient fern lineages .

What experimental approaches are optimal for expressing recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3?

The expression of recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3 requires careful consideration of expression systems, tags, and conditions to obtain functional protein. Based on the available literature and general practices for similar proteins, researchers should consider the following expression strategies:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coliHigh yield, cost-effective, rapid expressionPotential improper folding of membrane proteinsBL21(DE3) or C41/C43 strains, 16-20°C induction, N-terminal His-tag
YeastBetter folding for eukaryotic proteinsLower yield than E. coliPichia pastoris, methanol induction, 20-25°C
BaculovirusNative-like folding, post-translational modificationsComplex setup, higher costSf9 cells, 27°C, longer expression time
Cell-freeAvoids toxicity issues with membrane proteinsLower yield, higher costE. coli extract with added detergents or lipids

What role does NAD(P)H-quinone oxidoreductase play in chloroplast function and plant photosynthesis?

NAD(P)H-quinone oxidoreductase in chloroplasts plays several crucial roles in plant photosynthesis and stress responses:

In Angiopteris and other ferns, the high conservation of NDH complex components suggests their fundamental importance in photosynthetic function. This conservation is particularly significant in these ancient plant lineages that have survived across changing environmental conditions for millions of years, indicating the crucial adaptive value of this complex .

What purification methods are recommended for recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3?

Purification of recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3 requires specialized approaches due to its membrane-associated nature. The following purification strategy is recommended based on general protocols for similar proteins:

Purification StepMethodConditionsCritical Considerations
Cell LysisMechanical disruption or detergent extraction50 mM Tris-HCl pH 8.0, 150 mM NaCl, protease inhibitorsGentle lysis to maintain native structure
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)pH 7.5-8.0, 300-500 mM NaCl, 0.1-1% detergentSelection of appropriate detergent is crucial
Secondary PurificationSize Exclusion ChromatographypH 7.0-7.5, 150 mM NaCl, detergent below CMCSeparates monomeric from aggregated protein
Buffer ComponentsHEPES or Tris buffer, glycerol (10-20%), reducing agentpH 7.0-7.5, 1-5 mM DTT or β-mercaptoethanolStabilizes protein during purification

The choice of detergent is critical for membrane protein purification. Mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or Triton X-100 at concentrations above their critical micelle concentration (CMC) are typically suitable for extraction, while purification steps often use detergent concentrations just below CMC to maintain protein stability while minimizing micelle size .

For functional studies, it's essential to maintain the protein in an environment that preserves its native structure, which may require reconstitution into proteoliposomes or nanodiscs to create a membrane-like environment for activity assays.

How should storage conditions be optimized for maintaining the activity of recombinant NAD(P)H-quinone oxidoreductase?

Proper storage conditions are crucial for maintaining the structural integrity and functional activity of recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3. Based on information provided in the search results, the following storage recommendations should be considered:

  • Short-term storage (up to one week):

    • Store working aliquots at 4°C

    • Use Tris-based buffer with 50% glycerol

    • Include appropriate protease inhibitors and reducing agents

  • Long-term storage:

    • Store at -20°C for standard storage

    • Use -80°C for extended preservation

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

The recommended storage buffer typically includes:

  • 50 mM Tris-HCl (pH 7.5-8.0)

  • 150-200 mM NaCl

  • 50% glycerol as cryoprotectant

  • 1 mM DTT or other reducing agent

  • Appropriate detergent at concentrations slightly above CMC if dealing with the membrane-integrated form

For the highest stability, proteins can be flash-frozen in liquid nitrogen before transferring to -80°C storage. When needed, thaw samples on ice gradually to minimize protein denaturation .

How can researchers verify the proper folding and activity of recombinant NAD(P)H-quinone oxidoreductase?

Verifying the proper folding and activity of recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 3 requires multiple complementary approaches:

  • Structural integrity assessment:

    • SDS-PAGE for purity and expected molecular weight

    • Circular Dichroism (CD) spectroscopy to evaluate secondary structure content

    • Size exclusion chromatography to confirm monomeric state versus aggregation

    • Limited proteolysis to assess compactness of the folded structure

  • Functional assays:

    • NAD(P)H oxidation rates monitored by absorbance decrease at 340 nm

    • Quinone reduction measured by spectrophotometric methods

    • Inhibition studies using known inhibitors of quinone oxidoreductases like dicoumarol

  • Activity comparison:

    • Benchmark against activity parameters of related proteins

    • Control experiments with denatured enzyme to confirm specificity

A standard enzyme activity assay for NAD(P)H quinone oxidoreductases typically includes:

  • Buffer: 50 mM Tris-HCl or phosphate buffer, pH 7.4

  • Substrates: 100 μM NADH or NADPH, 50-100 μM quinone substrate

  • Temperature: 25-30°C

  • Detection: Continuous monitoring of absorbance at 340 nm

For membrane proteins like NAD(P)H-quinone oxidoreductase subunit 3, functional reconstitution into liposomes or nanodiscs may be necessary to provide a native-like membrane environment for optimal activity measurement .

How can research on Angiopteris evecta NAD(P)H-quinone oxidoreductase contribute to understanding plant evolution?

Research on Angiopteris evecta NAD(P)H-quinone oxidoreductase provides valuable insights into plant evolution for several reasons:

  • Evolutionary conservation: The remarkable conservation of chloroplast genes, including ndhC, across Marattiaceae supports the concept of "molecular living fossils." Comparative analyses reveal that three species of Angiopteris form a distinct clade with remarkably short branches, indicating minimal genetic differentiation despite potentially long divergence times .

  • Phylogenetic utility: The ndhC gene and other chloroplast genes serve as useful phylogenetic markers for resolving relationships among fern species. The complete chloroplast genome analysis shows Angiopteris yunnanensis is more closely related to Angiopteris evecta than to Angiopteris angustifolia, though all show high sequence conservation .

  • Structural conservatism: The quadripartite structure of the chloroplast genome (LSC, SSC, and two IR regions) is maintained across fern species, reflecting fundamental constraints in organellar genome evolution. This structural conservation extends to the encoded proteins, including ndhC .

  • Conservation genetics: Complete chloroplast genome sequences, including ndhC, provide resources for conservation management of ancient fern lineages. For example, Angiopteris yunnanensis has restricted occurrence in Karst formations in Guangxi, Yunnan, and Northern Vietnam, making conservation genetics approaches particularly valuable .

The study of these ancient proteins bridges the gap between molecular and morphological evolution, providing insights into how fundamental cellular processes have evolved while maintaining functional integrity over hundreds of millions of years. This research contributes to our understanding of the evolutionary history of photosynthesis and the genetic basis of plant adaptation across geological timescales.

What is the potential application of NAD(P)H-quinone oxidoreductase in anticancer research?

While the plant chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 itself is not directly applicable to cancer research, studies on related quinone oxidoreductases provide important insights into potential anticancer applications. The human homolog, NAD(P)H:quinone oxidoreductase 1 (NQO1), has significant implications in cancer biology:

  • Cancer cell targeting: NQO1 is often overexpressed in various cancer cells, making it a potential target for anticancer therapeutics. This differential expression allows for selective targeting of cancer cells while sparing normal tissues .

  • Prodrug activation: NQO1 can convert aziridinyl-substituted quinone-derived compounds into alkylating agents, resulting in cancer cell apoptosis. Compounds like AZ-1 have shown significant anticancer activities in nasopharyngeal carcinoma cells through NQO1-dependent mechanisms .

  • DNA damage induction: NQO1-activated compounds can induce DNA damage in cancer cells, as evidenced by increased expression of γH2AX (a DNA damage marker) and activation of apoptotic pathways involving caspase-8, caspase-9, and caspase-3 .

  • Therapeutic modulation: Inhibitors like dicoumarol can block NQO1 activity, reversing the effects of NQO1-activated compounds on cancer cell viability, DNA damage, and apoptosis. This provides mechanistic insights and potential therapeutic approaches .

Studies have demonstrated that compounds activated by NQO1, such as the di-aziridinyl-substituted quinone-derived compound AZ-1, can significantly inhibit the viability and survival of cancer cells, making NQO1 a promising target for anticancer drug development . Understanding the structure-function relationships in plant NAD(P)H-quinone oxidoreductases can contribute to broader knowledge of this enzyme family with potential applications in human health research.

What are the challenges in working with recombinant chloroplast proteins from non-model organisms like Angiopteris evecta?

Working with recombinant chloroplast proteins from non-model organisms like Angiopteris evecta presents several unique challenges:

  • Genomic resource limitations:

    • Incomplete genome information compared to model organisms

    • Limited annotation quality and potentially unresolved gene structures

    • Fewer validated genetic tools for manipulation and analysis

  • Expression optimization:

    • Codon usage bias may differ significantly from standard expression hosts

    • Potential toxicity when expressing membrane proteins in heterologous systems

    • Limited knowledge about protein processing and modification pathways specific to ferns

  • Functional characterization:

    • Lack of established functional assays specific to fern proteins

    • Limited understanding of natural substrates and interaction partners

    • Difficulty recreating the native chloroplast membrane environment

  • Evolutionary considerations:

    • Ancient lineages like Angiopteris may have unique features not present in model plants

    • Limited comparative data from closely related species

    • Potential unusual post-translational modifications or processing events

  • Technical challenges:

    • Need for specialized equipment to recreate appropriate redox conditions

    • Establishing proper membrane mimetics for membrane-associated proteins

    • Limited availability of antibodies or other detection reagents specific to fern proteins

Addressing these challenges requires interdisciplinary approaches combining genomics, biochemistry, and evolutionary biology. The recent sequencing of complete chloroplast genomes from multiple Angiopteris species represents an important step forward in providing resources for studying these ancient fern lineages . Comparative analyses with better-characterized systems can provide frameworks for experimental design while acknowledging the unique aspects of these ancient proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.