Recombinant Angiopteris evecta NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we accommodate specific format requests. Please indicate your preferred format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, we recommend consulting your local distributors.
Note: Our proteins are standardly shipped with regular blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
ndhE
Target Protein Sequence
MIENALILGAYLFCIGFYGLITSRNMIRALMCLELIFNAVNINFVTFSNYFDTQERKGEI FSISVIAIAAAEAAIGLSIILIIYRNRKSTRIDQFNLLKW
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. NDH couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 4L?

Angiopteris evecta NAD(P)H-quinone oxidoreductase subunit 4L is a chloroplastic protein that functions as part of the electron transport chain within chloroplasts. This protein belongs to a family of flavin adenine dinucleotide-dependent flavoproteins that promote obligatory two-electron reductions of quinones and similar substrates . Similar to other NAD(P)H-quinone oxidoreductases, it likely utilizes NAD(P)H as an electron donor to catalyze the reduction of quinones to hydroquinones, a process that prevents the formation of reactive semiquinone intermediates . The protein is encoded by the plastid genome of Angiopteris evecta, which has been fully sequenced and characterized as 153,901 bp with typical organization for vascular plants . Its chloroplastic localization suggests it plays an important role in photosynthetic processes, possibly protecting the photosynthetic apparatus from oxidative damage during periods of environmental stress.

The specific structural elements of this protein have not been extensively characterized in the provided information, but based on homologous proteins, it likely contains conserved domains for NAD(P)H binding and quinone substrate interaction. The protein's function appears related to ceQORH (chloroplast envelope Quinone Oxidoreductase Homolog), which exhibits NADPH-dependent α,β-unsaturated oxoene reductase activity, reducing double bonds of medium to long-chain reactive electrophile species derived from poly-unsaturated fatty acid peroxides . This suggests potential roles in detoxification pathways and protection against oxidative stress in chloroplasts.

How does the Angiopteris evecta NAD(P)H-quinone oxidoreductase differ from other plant species' homologs?

Unlike many model plant systems, Angiopteris evecta represents a marattioid fern lineage that is considered one of the most primitive extant fern groups, making its enzymes valuable for comparative studies of plant metabolism evolution. The specific subunit 4L of the NAD(P)H-quinone oxidoreductase is encoded in the chloroplast genome, which in Angiopteris has inverted repeats of 21,053 bp each, a large single-copy region of 89,709 bp, and a small single-copy region of 22,086 bp . These genomic features may influence the expression and regulation of the enzyme compared to homologs in other plant species. Functional studies suggest that like other plant NAD(P)H-quinone oxidoreductases, the Angiopteris enzyme likely serves protective roles against oxidative stress, but may have evolved specific substrate preferences or regulatory mechanisms suited to the ecological niche of this ancient fern species.

What is the physiological role of NAD(P)H-quinone oxidoreductase in chloroplast function?

NAD(P)H-quinone oxidoreductases in chloroplasts primarily function as detoxifying enzymes that protect the photosynthetic apparatus from oxidative damage. In chloroplasts, these enzymes help maintain redox homeostasis by preventing the formation of reactive oxygen species (ROS) that can damage cellular components . The enzyme accomplishes this by catalyzing obligatory two-electron reductions of quinones to hydroquinones, which prevents the one-electron reduction pathway that would lead to the formation of highly reactive semiquinone radicals . This detoxification mechanism is particularly important during photosynthesis, when electron transport chains can leak electrons to oxygen, generating superoxide and other ROS.

Evidence from related chloroplastic quinone oxidoreductases suggests that the Angiopteris enzyme may specifically detoxify 13-lipoxygenase-derived γ-ketols at their production sites in the chloroplast membranes . These γ-ketols are spontaneously produced from unstable allene oxides formed in the biochemical pathway leading to 12-oxo-phytodienoic acid, a precursor of the defense hormone jasmonate . This function would link the enzyme to plant defense responses and stress signaling pathways. Additionally, the enzyme's ability to reduce α,β-unsaturated carbonyls, which are toxic reactive electrophile species produced during oxidative stress, further supports its role in protecting chloroplast function under adverse conditions . The chloroplast localization of this enzyme is critical for its physiological function, as it allows for the immediate neutralization of reactive species at their site of generation.

What are the optimal conditions for expressing and purifying recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase?

The optimal expression and purification of recombinant Angiopteris evecta NAD(P)H-quinone oxidoreductase requires careful consideration of expression systems, tags, and buffer conditions to maintain enzyme stability and activity. Based on similar proteins, a bacterial expression system such as E. coli BL21(DE3) with a pET vector containing the codon-optimized gene sequence would likely provide good yields . The recombinant protein expression should be induced at lower temperatures (16-18°C) rather than the standard 37°C to enhance proper folding and solubility of this chloroplastic protein. Addition of a His-tag or GST-tag allows for affinity purification, with the His-tag being preferable if the goal is structural studies as it minimally impacts protein structure.

For purification, a multi-step approach should be employed, beginning with affinity chromatography (Ni-NTA for His-tagged proteins), followed by ion-exchange chromatography and size-exclusion chromatography to achieve high purity. Buffer optimization is critical, with typical buffers containing 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0), 100-300 mM NaCl, 5-10% glycerol, and 1-5 mM DTT or β-mercaptoethanol to maintain reduced cysteine residues . Including FAD (flavin adenine dinucleotide) in purification buffers may enhance stability as this cofactor is essential for enzyme function. Enzyme activity should be monitored throughout purification using standardized assays measuring the NADPH-dependent reduction of model substrates such as dichlorophenolindophenol (DCPIP) or natural substrates like quinones or γ-ketols if available. Storage conditions should include flash-freezing in liquid nitrogen with 20-30% glycerol as a cryoprotectant, and storage at -80°C to preserve long-term activity.

What enzymatic assay methods are most effective for measuring NAD(P)H-quinone oxidoreductase activity in vitro?

Several enzymatic assay methods can effectively measure NAD(P)H-quinone oxidoreductase activity, with spectrophotometric approaches being the most common due to their simplicity and reliability. The primary assay involves monitoring the oxidation of NADPH at 340 nm (ε = 6,220 M⁻¹cm⁻¹), which decreases in absorbance as the reaction proceeds . This can be coupled with the reduction of various electron acceptors such as dichlorophenolindophenol (DCPIP), whose reduction can be monitored at 600 nm, providing a convenient colorimetric readout. For more specific substrates, assays can monitor the reduction of natural quinones like ubiquinone or plastoquinone using HPLC-based methods to separate and quantify the reduced products.

For the specific activity of α,β-unsaturated carbonyl reduction (as observed with ceQORH), researchers can employ synthetic substrates like trans-2-hexenal or 4-hydroxynonenal and monitor their reduction using HPLC or GC-MS methods . When working with the purified enzyme, reaction conditions should be optimized for pH (typically 7.0-8.0), temperature (often 25-30°C), and ionic strength. A standard reaction mixture might contain 50 mM Tris-HCl (pH 7.5), 100-200 μM NADPH, 50-100 μM substrate, and an appropriate amount of purified enzyme. Kinetic parameters (Km, Vmax, kcat) should be determined under conditions where substrate concentrations span at least 0.2-5 times the Km value. To distinguish the activity from other oxidoreductases, specific inhibitors can be employed, such as dicoumarol which inhibits NQO1-like enzymes, or flavonoids like orientin which have been identified as potent inhibitors through competitive inhibition of NAD(P)H .

How can researchers effectively analyze the subcellular localization of NAD(P)H-quinone oxidoreductase in Angiopteris evecta cells?

Analyzing the subcellular localization of NAD(P)H-quinone oxidoreductase in Angiopteris evecta cells requires specialized approaches due to the challenges of working with fern tissues. Researchers should employ a combination of biochemical fractionation and microscopy techniques to definitively determine the protein's localization within chloroplasts. Cellular fractionation begins with careful homogenization of Angiopteris evecta fronds or gametophytes in an isotonic buffer containing protease inhibitors, followed by differential centrifugation to separate cellular compartments including chloroplasts, mitochondria, and cytosol. The purity of fractions should be verified using marker enzymes (such as Rubisco for chloroplasts) before performing Western blot analysis using antibodies specific to the NAD(P)H-quinone oxidoreductase protein.

For microscopy approaches, immunolocalization with confocal microscopy provides high-resolution imaging of the protein's distribution. Tissue sections or isolated protoplasts can be fixed, permeabilized, and incubated with primary antibodies against the target protein, followed by fluorophore-conjugated secondary antibodies. Co-localization with known chloroplast markers (using different fluorophores) can confirm the chloroplastic localization . Alternatively, researchers can create fusion constructs with fluorescent reporters (GFP, YFP) attached to the NAD(P)H-quinone oxidoreductase for expression in model plant systems, though this approach may be challenging in ferns. For even greater precision, immunogold electron microscopy can determine the exact suborganellar localization (thylakoid membrane, stroma, or envelope membrane) within the chloroplast. The challenge of limited genetic tools for ferns can be partially overcome by heterologous expression systems, where the Angiopteris gene with its native targeting sequence is expressed in model plants like Arabidopsis to verify its chloroplast import capability.

How does the enzyme's function correlate with the traditional medicinal properties of Angiopteris evecta?

The traditional medicinal properties of Angiopteris evecta, particularly its use as an antidote for snake bites and insect stings by the Tangsa tribe of Arunachal Pradesh, may correlate with the detoxifying functions of NAD(P)H-quinone oxidoreductase and other enzymes present in the plant . Snake venoms and insect toxins often contain compounds that induce oxidative stress and cellular damage through the generation of reactive oxygen species. NAD(P)H-quinone oxidoreductases function as detoxifying enzymes that catalyze the reduction of quinones and prevent the formation of harmful semiquinone radicals, potentially counteracting some of the oxidative damage caused by venoms . The enzyme's ability to reduce reactive α,β-unsaturated carbonyl compounds, which are toxic molecules produced during oxidative stress, may contribute to neutralizing secondary effects of envenomation.

Additionally, Angiopteris evecta contains bioactive compounds like angiopteroside (4-O-beta-D-Glucopyranosyl-L-thero-2-hexen-5-olide) that contribute to its pharmaceutical properties . This compound has been reported to inhibit HIV-1, suggesting broad biological activity. The plant also demonstrates antiplasmodial, antibacterial, antifungal, and antituberculosis properties, indicating a complex phytochemical profile beyond just the action of NAD(P)H-quinone oxidoreductase . The rhizome, which is the part traditionally used as an antidote, likely contains a mixture of bioactive compounds that work synergistically. To establish direct correlations between the enzyme's function and medicinal properties, researchers should conduct bioassay-guided fractionation of Angiopteris evecta extracts, followed by identification and characterization of active compounds. Testing the effects of purified NAD(P)H-quinone oxidoreductase or its substrates/products on venom components in vitro could provide mechanistic insights into the traditional uses of this endangered fern.

What structural features of the enzyme contribute to its substrate specificity and catalytic efficiency?

The substrate specificity and catalytic efficiency of NAD(P)H-quinone oxidoreductase are determined by key structural features in its active site and surrounding regions. Though specific structural data for the Angiopteris evecta enzyme is not provided in the search results, insights can be drawn from related enzymes. NAD(P)H-quinone oxidoreductases typically contain a conserved FAD-binding domain that is critical for their catalytic function, allowing electron transfer from NAD(P)H to substrates . The enzyme likely possesses a distinct NAD(P)H binding pocket that facilitates the correct orientation of this cofactor for efficient hydride transfer. The substrate binding site must accommodate various quinones and potentially α,β-unsaturated carbonyl compounds, suggesting a relatively flexible binding pocket that can interact with different electrophilic substrates.

For chloroplastic quinone oxidoreductases like ceQORH, research indicates specific activity toward medium-chain (C⩾9) to long-chain (18 carbon atoms) reactive electrophile species derived from poly-unsaturated fatty acid peroxides, with particular efficiency for 13-lipoxygenase-derived γ-ketols . This substrate preference suggests the presence of a hydrophobic binding pocket that can accommodate the long carbon chains of these substrates. The enzyme's ability to specifically reduce the double bond of α,β-unsaturated carbonyl compounds indicates precise positioning of catalytic residues that direct the hydride transfer to the β-carbon. Catalytic efficiency is likely enhanced by residues that stabilize the transition state during hydride transfer, as well as by proper positioning of the FAD cofactor relative to both NAD(P)H and the substrate. To fully elucidate these structural features, researchers should pursue X-ray crystallography or cryo-electron microscopy studies of the enzyme in complex with substrates or substrate analogs, complemented by site-directed mutagenesis of predicted catalytic and substrate-binding residues to confirm their roles in specificity and efficiency.

How does the enzyme respond to environmental stress conditions and what role does it play in plant adaptation?

NAD(P)H-quinone oxidoreductase likely plays a significant role in plant adaptation to environmental stress conditions by protecting cellular components from oxidative damage. During environmental stresses such as high light, drought, temperature extremes, or pathogen attack, plants experience increased production of reactive oxygen species (ROS) and lipid peroxidation products that can damage cellular structures . The enzyme's ability to detoxify reactive electrophile species, particularly α,β-unsaturated carbonyls and quinones, would provide protection against these oxidative stress byproducts. This detoxification mechanism is especially critical in chloroplasts, which are major sites of ROS production during photosynthesis under stress conditions.

Research on related proteins indicates that NAD(P)H-quinone oxidoreductase expression and activity may increase in response to oxidative stress, suggesting transcriptional or post-translational regulation mechanisms that enhance the plant's detoxification capacity when needed . The enzyme's apparent preference for 13-lipoxygenase-derived γ-ketols links it to the jasmonate signaling pathway, which is a key mediator of plant stress responses and defense against herbivores and pathogens . This connection suggests that the enzyme may participate in stress signaling networks beyond its direct detoxification role. In Angiopteris evecta, an ancient fern species that has survived numerous environmental changes over evolutionary time, the NAD(P)H-quinone oxidoreductase may have evolved specific adaptations that contribute to the plant's resilience. Future research should investigate the enzyme's expression patterns under various stress conditions, its regulation by stress-responsive transcription factors, and potential protein modifications that might modulate its activity in response to environmental cues. Comparative studies with homologous enzymes from other plant species adapted to different ecological niches could provide insights into how this enzyme contributes to stress adaptation across the plant kingdom.

What bioinformatic approaches are most effective for analyzing evolutionary conservation of NAD(P)H-quinone oxidoreductase across plant lineages?

Effective bioinformatic analysis of evolutionary conservation of NAD(P)H-quinone oxidoreductase across plant lineages requires a multi-faceted approach combining sequence analysis, phylogenetics, and structural prediction. Researchers should begin by retrieving all available homologous sequences from diverse plant taxa, including angiosperms, gymnosperms, ferns (including Angiopteris evecta), lycophytes, bryophytes, and algae, using databases such as GenBank, Phytozome, and 1KP (One Thousand Plant Transcriptomes). Multiple sequence alignment using tools like MUSCLE or MAFFT will identify conserved domains, active sites, and substrate-binding regions across lineages. Visualization of these alignments with programs like Jalview can highlight conservation patterns and lineage-specific variations.

Phylogenetic analysis should employ both maximum likelihood (using RAxML or IQ-TREE) and Bayesian inference methods (using MrBayes or BEAST) to construct robust evolutionary trees, with careful selection of appropriate evolutionary models using model-testing software like ModelTest-NG. These phylogenies should be calibrated with fossil evidence where possible to estimate divergence times of NAD(P)H-quinone oxidoreductase variants across plant evolution. Selective pressure analysis using tools like PAML can identify sites under positive, neutral, or purifying selection, providing insights into functional constraints on the enzyme throughout evolutionary history. For structural conservation analysis, homology modeling using tools like SWISS-MODEL or AlphaFold can predict three-dimensional structures based on the Angiopteris sequence and compare them with known structures of related enzymes . Conservation mapping onto these structural models using tools like ConSurf can visualize evolutionary constraints in a structural context, particularly around catalytic sites and substrate-binding pockets. The analysis of synteny and gene neighborhood conservation using tools like SynMap can provide additional insights into the genomic context evolution of these genes, particularly for the chloroplast-encoded subunit in Angiopteris evecta, which can be compared with the complete plastid genome information available (GenBank accession number DQ821119) .

How can researchers differentiate between the activities of different NAD(P)H-quinone oxidoreductase isoforms in complex biological samples?

Differentiating between the activities of different NAD(P)H-quinone oxidoreductase isoforms in complex biological samples requires a combination of biochemical, immunological, and genetic approaches to achieve specificity. Researchers should begin with activity-based assays that exploit the differential substrate preferences and inhibitor sensitivities of various isoforms. For example, the chloroplastic NAD(P)H-quinone oxidoreductase from Angiopteris evecta might preferentially reduce specific chloroplast quinones or γ-ketols compared to cytosolic isoforms . By testing activity with a panel of substrates under varying pH and salt conditions, researchers can develop a "fingerprint" for each isoform's activity profile. Inhibitor studies using compounds like dicoumarol, flavonoids (like orientin), or other specific inhibitors at varying concentrations can further distinguish between isoforms based on their differential sensitivity .

Immunological approaches provide another layer of specificity through the development of isoform-specific antibodies. These can be used in immunodepletion experiments where specific isoforms are selectively removed from samples before activity assays, or in immunoprecipitation followed by activity measurements. Western blotting with isoform-specific antibodies can quantify the amount of each protein present, allowing calculation of specific activities. For higher resolution analysis, chromatographic separation methods including ion exchange, hydrophobic interaction, or size exclusion chromatography can physically separate different isoforms before activity measurement. Mass spectrometry-based approaches, particularly activity-based protein profiling (ABPP) using probe molecules that bind specifically to active NAD(P)H-quinone oxidoreductases, can identify and quantify different isoforms in complex mixtures. This can be combined with targeted proteomics approaches like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) for sensitive and specific quantification. In genetically tractable systems, RNAi or CRISPR-based knockdown/knockout of specific isoforms can create reference samples with defined isoform compositions for comparative analysis. For the specific case of the chloroplastic enzyme from Angiopteris evecta, subcellular fractionation to isolate chloroplasts before activity measurements provides an important first step in distinguishing its activity from that of non-chloroplastic isoforms.

What are the key considerations for analyzing structure-function relationships in NAD(P)H-quinone oxidoreductase through site-directed mutagenesis?

Analyzing structure-function relationships in NAD(P)H-quinone oxidoreductase through site-directed mutagenesis requires careful experimental design and comprehensive functional analysis to yield meaningful insights. The first critical step is identifying candidate residues for mutagenesis based on multiple lines of evidence, including sequence conservation analysis across evolutionary lineages, structural information from homology models or crystal structures of related enzymes, computational predictions of functional sites, and literature on similar enzymes . Key targets should include residues in the NAD(P)H binding pocket, FAD binding domain, substrate binding region, and potential catalytic residues involved in electron transfer. Researchers should design a comprehensive mutation strategy that includes conservative substitutions (maintaining similar physicochemical properties) to assess subtle functional contributions, non-conservative substitutions to dramatically alter properties, and alanine scanning of specific regions to identify essential residues.

What are the optimal approaches for studying the in vivo function of NAD(P)H-quinone oxidoreductase in Angiopteris evecta?

Studying the in vivo function of NAD(P)H-quinone oxidoreductase in Angiopteris evecta presents unique challenges due to the limited genetic tools available for ferns, requiring creative experimental approaches. Researchers should begin with expression profiling across different tissues, developmental stages, and stress conditions using RT-qPCR or RNA-Seq to determine when and where the enzyme is most active, providing clues to its physiological roles. This can be complemented by activity assays using native protein extracts from different tissues to correlate expression with enzymatic activity. Metabolomic profiling using LC-MS/MS or GC-MS to identify and quantify potential substrates and products (such as quinones, hydroquinones, and γ-ketols) across different physiological conditions can provide indirect evidence of the enzyme's in vivo function .

Given the limitations of genetic manipulation in ferns, virus-induced gene silencing (VIGS) may offer a viable approach for knockdown studies if appropriate viral vectors can be adapted for Angiopteris evecta. Alternatively, pharmacological approaches using specific inhibitors of NAD(P)H-quinone oxidoreductase activity applied to whole plants or tissues, followed by physiological and biochemical analyses, can provide insights into the consequences of enzyme inhibition. For studying protein-protein interactions and complex formation in vivo, co-immunoprecipitation with antibodies against the native protein, followed by mass spectrometry analysis of binding partners, can reveal functional associations within cellular pathways. Advanced microscopy techniques such as FRET (Förster resonance energy transfer) or FLIM (fluorescence lifetime imaging microscopy) using fluorescently labeled antibodies against the enzyme and potential interacting proteins can visualize interactions in situ. To overcome the genetic limitations of working directly with Angiopteris, heterologous expression of the fern enzyme in model plant systems like Arabidopsis, particularly in mutant lines lacking homologous enzymes, can allow complementation studies to assess functional conservation across species. Finally, comparative physiological studies between wild populations of Angiopteris evecta growing in different environmental conditions might reveal correlations between enzyme activity levels and adaptation to specific stresses, providing ecological context for its function.

What analytical technologies are most appropriate for characterizing the reaction mechanisms and kinetics of NAD(P)H-quinone oxidoreductase?

Characterizing the reaction mechanisms and kinetics of NAD(P)H-quinone oxidoreductase requires sophisticated analytical technologies that can capture the details of electron transfer processes and substrate transformations. Steady-state kinetic analysis using spectrophotometric assays remains fundamental, measuring initial velocities across various substrate and NAD(P)H concentrations to determine kinetic parameters (Km, kcat, kcat/Km) and establish the reaction order and kinetic mechanism (ping-pong vs. sequential) . These studies should be conducted across different pH values and temperatures to determine optimal conditions and derive thermodynamic activation parameters. For deeper mechanistic insights, pre-steady-state kinetics using stopped-flow spectrophotometry with rapid mixing capabilities can resolve individual steps in the catalytic cycle, including substrate binding, electron transfer from NAD(P)H to FAD, and subsequent transfer to the quinone substrate.

Advanced spectroscopic techniques are essential for tracking electron movement during catalysis. Rapid-scan UV-visible spectroscopy can monitor changes in the redox state of the FAD cofactor, while fluorescence spectroscopy can detect conformational changes during substrate binding and catalysis. Electron paramagnetic resonance (EPR) spectroscopy is particularly valuable for detecting and characterizing any semiquinone radical intermediates that might form during the reaction. For studying hydrogen transfer mechanisms, kinetic isotope effects using deuterated NAD(P)H or substrates can distinguish between tunneling mechanisms and classical over-the-barrier transfer. Mass spectrometry techniques, particularly rapid-quench coupled with LC-MS/MS, can identify and quantify reaction intermediates and products, providing a comprehensive view of the reaction pathway . To establish the stereochemistry of hydride transfer, researchers can employ stereospecifically labeled NAD(P)H and analyze the products using NMR spectroscopy. X-ray crystallography or cryo-electron microscopy of the enzyme in complex with substrates, products, or transition state analogs can provide structural snapshots along the reaction coordinate. Computational approaches including quantum mechanics/molecular mechanics (QM/MM) simulations can integrate experimental data into comprehensive models of the reaction mechanism, particularly useful for understanding the energetics of electron and proton transfer steps. Together, these technologies can provide a detailed understanding of the catalytic mechanism at the atomic and electronic levels.

How can researchers effectively isolate and characterize natural substrates for NAD(P)H-quinone oxidoreductase from Angiopteris evecta tissues?

Effective isolation and characterization of natural substrates for NAD(P)H-quinone oxidoreductase from Angiopteris evecta tissues requires a systematic approach combining extraction methods, activity-guided fractionation, and advanced analytical techniques. Researchers should begin with optimized extraction protocols tailored to the chemical nature of potential substrates. For quinones and lipophilic substrates, sequential extraction with solvents of increasing polarity (hexane, chloroform, ethyl acetate, methanol, water) can separate compounds based on polarity. For γ-ketols and other reactive electrophile species derived from lipid peroxidation, extraction methods should include antioxidants (BHT, ascorbic acid) to prevent artifact formation during isolation . Subcellular fractionation to isolate chloroplasts before extraction can enrich for physiologically relevant substrates present in the enzyme's native compartment.

Activity-guided fractionation serves as a powerful approach to identify natural substrates. Extracts and fractions can be tested for their ability to act as substrates for the purified recombinant enzyme by monitoring NAD(P)H oxidation rates spectrophotometrically. Active fractions should undergo further separation using techniques such as preparative HPLC with different column chemistries (C18, HILIC, chiral columns) to isolate individual compounds. For comprehensive characterization, researchers should employ a multi-platform analytical approach. High-resolution LC-MS/MS with accurate mass determination can provide molecular formulas of potential substrates, while MS/MS fragmentation patterns can yield structural information. Nuclear magnetic resonance spectroscopy (1H, 13C, 2D experiments like COSY, HSQC, HMBC) of purified compounds is essential for complete structure elucidation. For quinones, UV-visible spectroscopy before and after reduction can provide characteristic absorption profiles that help confirm their identity. To validate physiological relevance, metabolomic approaches comparing substrate levels across different tissues and stress conditions can establish correlations with enzyme expression and activity. Isotopic labeling studies, where plants are fed with stable isotope-labeled precursors (e.g., 13C-glucose), can trace the biosynthetic origins of identified substrates and confirm their endogenous nature. Finally, synthetic standards of identified compounds should be prepared to confirm identifications and establish structure-activity relationships through kinetic analysis with the purified enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.