Recombinant Angiopteris evecta Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Photosystem II

psbB (CP47) is integral to PSII’s light-harvesting and charge-separation processes:

Core Functions

  • Light Harvesting: Binds chlorophyll a and transfers excitation energy to the reaction center (RC) .

  • RC Stabilization: Anchors the D1 and D2 proteins, ensuring proper orientation of the P680 special pair and pheophytins .

  • Oxygen Evolution: Interacts with the oxygen-evolving enhancer (OEE) proteins (33 kDa, 23 kDa, 17 kDa) to stabilize the Mn₄CaO₅ cluster .

Recombinant Production and Purification

The recombinant psbB is produced via heterologous expression systems, with protocols optimized for stability and functionality:

ParameterE. coliMammalian Cells
YieldHighModerate
Post-Translational ModificationsLimitedNative folding and disulfide bonds
Chlorophyll BindingRequires in vitro reconstitutionNative-like binding (partial)
ApplicationsStructural studies, immunoblottingFunctional assays, interaction studies

Purification typically involves:

  1. Metal Affinity Chromatography: Utilizes the His tag for initial capture .

  2. Gel Filtration: Refines purity by separating monomers from aggregates .

  3. Reconstitution: In vitro chlorophyll binding is performed for E. coli-derived protein to restore native activity .

Comparative Genomics

  • Sequence Homology: Angiopteris evecta psbB shares ~70% identity with spinach and Arabidopsis orthologs, reflecting conserved functional domains .

  • Plastid Genome Evolution: psbB is retained in the plastid genome of land plants, unlike many genes relocated to the nucleus .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade recombinant psbB, necessitating optimized storage protocols .

  • Functional Reconstitution: E. coli-derived psbB requires in vitro chlorophyll binding, limiting its use in dynamic studies .

  • Evolutionary Studies: Leveraging psbB from non-model organisms like Angiopteris evecta could reveal adaptive variations in PSII efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For accurate delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is preferred, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your order.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHLMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRIGITKSWGGWSITGDTVNDAGIWSYEGVAASHIVLSGLLFLAAIWHWVYWDL DLFRDERTGKPSLDLPKIFGIHLFLSGVLCFGFGAFHITGLFGPGIWVSDPYGLTGKVQP VDPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIDRRIRASKAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHATFKDKEGHELFVRRMP TFFETFPVVLVDEEGVVRADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALIFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47 chlorophyll apoprotein (psbB) is a key component of the core complex within photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that is subsequently used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should recombinant CP47 be stored and handled in laboratory settings?

For optimal stability and activity, recombinant Angiopteris evecta CP47 protein should be stored according to these guidelines:

  • Store at -20°C for regular use, or at -80°C for extended storage periods

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein stability

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom before opening

  • For reconstitution of lyophilized protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • When preparing for long-term storage, add glycerol to a final concentration of 5-50% before aliquoting

These storage conditions are critical for maintaining protein integrity and ensuring experimental reproducibility.

What experimental systems are commonly used to study CP47 function?

Several experimental systems have proven valuable for investigating CP47 function:

Experimental SystemApplicationsAdvantages
Cyanobacterial models (e.g., Synechocystis sp. PCC 6803)Site-directed mutagenesis, functional analysisGenetic tractability, similar PSII structure to higher plants
PS I-less/apcE-background strainsIsolated study of PSII functionReduced background interference from PSI
Recombinant protein expressionStructural studies, antibody productionControlled protein production, tag options for purification
77K fluorescence spectroscopyAssessment of energy transfer efficiencyHigh sensitivity to subtle changes in PSII function
Oxygen evolution measurementsQuantification of PSII activityDirect functional readout

Researchers commonly employ the cyanobacterium Synechocystis sp. PCC 6803 for site-directed mutagenesis studies of CP47, as this organism allows for targeted genetic modifications while maintaining a photosynthetic apparatus similar to that of higher plants . In particular, the PS I-less/apcE-background strain provides a simplified system for studying PSII function without interference from PSI-related processes .

How do mutations in conserved histidine residues affect CP47 function and photosystem II activity?

These findings highlight the critical role of histidine residues in CP47 as chlorophyll ligands and their importance for maintaining proper energy transfer within photosystem II.

What role does CP47 play in photosystem II assembly and repair mechanisms?

CP47 serves multiple critical functions during photosystem II (PSII) assembly and repair processes:

  • Assembly intermediate formation: CP47 is incorporated into the RC47 assembly intermediate (D1-D2-cytochrome b559 complex with CP47) . This step is essential for subsequent addition of CP43 and other subunits to form the complete PSII complex.

  • Interaction with assembly factors:

    • The C-terminus of CP47 regulates the binding of Psb28, an assembly factor that protects PSII intermediates during biogenesis

    • In the Psb28-free complex (PSII-M), the CP47 C-terminus blocks the Psb28 binding site by interacting with the D1 D-E loop

    • CP47 interacts with Psb34, a single transmembrane helix protein identified in PSII assembly intermediates

  • Integration with repair mechanisms: CP47 participates in the PSII repair cycle, allowing damaged D1 protein to be replaced without complete disassembly of the entire complex. Psb28 association with CP47 during repair provides protection by blocking electron transport to the acceptor side of PSII, shielding it from excess photodamage .

  • Structural scaffold function: The proper folding and positioning of CP47 creates binding sites for multiple small membrane-intrinsic subunits essential for PSII stability.

The strategic positioning of CP47 within the PSII complex makes it a crucial component for both de novo assembly and the repair cycle of photosystem II.

How can fluorescence spectroscopy be used to assess CP47 function in mutant strains?

Fluorescence spectroscopy provides powerful insights into CP47 function in mutant strains through several complementary approaches:

These spectroscopic techniques, when used in combination, provide a comprehensive assessment of how specific mutations affect CP47 structure and function within the photosynthetic apparatus.

What molecular mechanisms govern the interaction between CP47 and assembly factors like Psb28 and Psb34?

The interactions between CP47 and assembly factors Psb28 and Psb34 involve complex molecular mechanisms that are essential for proper photosystem II assembly:

  • CP47-Psb28 interaction:

    • Chemical cross-linking and mass spectrometry have revealed that Psb28 binds to the cytosolic side of CP47

    • This binding occurs in close proximity to cytochrome b559 and the QB binding site

    • The C-terminus of CP47 plays a regulatory role, blocking the Psb28 binding site by interacting with the D1 D-E loop in the Psb28-free complex (PSII-M)

    • This arrangement prevents reverse assembly processes, ensuring directional assembly of PSII

  • CP47-Psb34 interaction:

    • Psb34 is a small, single transmembrane helix protein that binds specifically to CP47

    • It associates with CP47 in close proximity to PsbH

    • The conserved long N-terminal arm of Psb34 is positioned at the side and top of the D2 subunit

    • Mass spectrometry confirms this interaction in PSII assembly intermediates

    • Isolation of Strep-tagged Psb34 complexes indicates a specific role in facilitating CP43 attachment to the RC47 complex

  • Protective mechanisms:

    • The strategic binding of Psb28 to CP47 blocks electron transport to the acceptor side of PSII, protecting the RC47 complex from photodamage during assembly

    • This protective role is supported by the observation that Psb28 is also found in PSII repair complexes

  • Coordination with other assembly factors:

    • CP47 interactions must be coordinated with other assembly factors like Psb27, which stabilizes the CP43 luminal domain

    • This coordination facilitates the assembly of the oxygen-evolving complex (OEC)

These molecular interactions represent a sophisticated network of assembly factors that guide the stepwise assembly of PSII, with CP47 serving as a key interaction hub.

How does light regulation influence CP47 expression and function within photosystem II?

Light plays a vital role in regulating CP47 expression and function through several interconnected mechanisms:

  • Transcriptional and translational regulation:

    • Similar to the psbA gene (encoding D1 protein), expression of proteins in the photosynthetic apparatus, including CP47, is influenced by light conditions

    • While psbA shows the highest level of light induction, the expression of other PSII components including CP47 is coordinated to maintain proper stoichiometry

  • Control by epistasy of synthesis (CES process):

    • CP47 expression is regulated through the CES process during chloroplast protein biogenesis

    • This regulatory mechanism ensures balanced synthesis of interacting subunits within protein complexes

    • The accumulation of unassembled CP47 can feedback to regulate its own synthesis, preventing wasteful protein production

  • Light-dependent energy transfer function:

    • CP47's role as a light-harvesting antenna protein makes its function directly responsive to light conditions

    • The efficiency of excitation energy transfer from CP47 to the reaction center varies under different light intensities

    • In CP47 histidine mutants, reduced light-harvesting efficiency is particularly evident when analyzing light intensity dependence of electron transport

  • Integration with repair mechanisms:

    • High light stress increases photodamage to PSII, particularly the D1 protein

    • During PSII repair, CP47 interactions with assembly factors like Psb28 protect the complex from further damage during D1 replacement

    • This protection is especially important under high light conditions when repair processes are accelerated

Understanding these light-dependent mechanisms provides insights into how photosynthetic organisms maintain optimal PSII function across varying environmental conditions.

What approaches are effective for studying CP47 in transgenic systems and heterologous expression?

Several approaches have proven effective for studying CP47 in transgenic and heterologous expression systems:

  • Site-directed mutagenesis in cyanobacteria:

    • Synechocystis sp. PCC 6803 provides an excellent platform for introducing targeted mutations to CP47

    • The use of specialized genetic backgrounds (e.g., PS I-less/apcE- strains) allows isolation of PSII-specific effects

    • Assessment of mutant phenotypes through fluorescence spectroscopy and oxygen evolution measurements provides functional insights

  • Recombinant protein expression strategies:

    • Expression in E. coli with appropriate tags (e.g., His-tag) facilitates protein purification and characterization

    • Proper storage in Tris-based buffer with glycerol maintains protein stability

    • Integration of codon optimization and fusion protein approaches can enhance expression levels

  • Chloroplast transformation for high-level expression:

    • Plastid transformation offers several advantages for expressing photosynthetic proteins

    • Optimization of 5' untranslated regions (UTRs) can enhance translation efficiency

    • Designing prokaryotic ribosome binding sites (RBS) with appropriate algorithms can achieve desired translation rates

    • Fusion of recombinant products to native proteins can significantly increase protein yield (as demonstrated with luciferase showing 33-fold increase when fused to rubisco LSU)

  • Protein tagging strategies for CP47 studies:

    • Affinity tags facilitate isolation of CP47-containing complexes and interacting partners

    • Strep-tagging of assembly factors like Psb34 has been used to confirm interactions with CP47 in PSII assembly intermediates

    • Cleavable domains between CP47 and fusion partners simplify product purification

These approaches provide researchers with a versatile toolkit for investigating CP47 structure, function, and interactions in controlled experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.