Recombinant Angiopteris evecta Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Angiopteris evecta Photosystem Q(B) protein is a synthetic version of the native Photosystem II (PSII) D1 protein (also known as the Q(B) protein) derived from Angiopteris evecta, a fern species. This protein is critical for light-dependent reactions in photosynthesis, specifically in electron transport and herbicide binding . Its recombinant form is produced via bacterial expression systems, enabling controlled studies of its structure, function, and interactions in plant biology and biotechnology .

Production and Purification

The recombinant protein is synthesized in E. coli using bacterial expression vectors. Key steps include:

  1. Cloning: Insertion of the psbA gene into an expression vector.

  2. Induction: Overexpression under optimized conditions.

  3. Purification: Affinity chromatography via His-tag followed by SDS-PAGE validation .

Critical Handling Notes

  • Stability: Lyophilized or glycerol-stabilized forms are preferred to prevent degradation .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

Functional Role in Photosynthesis

The Q(B) protein is integral to PSII’s light-dependent reactions:

  • Electron Transport: Facilitates transfer of electrons from the Q(A) site to the cytochrome b₅₆₀ complex .

  • Herbicide Binding: Targets site Q(B) for herbicides like atrazine, disrupting photosynthetic activity .

  • Chloroplast Biogenesis: Interacts with regulatory proteins (e.g., NCP) to activate plastid-encoded genes (PhAPGs) .

Regulatory Interactions
Studies in Arabidopsis reveal that dual-targeted proteins like NCP coordinate nuclear and plastidial signaling to activate PSII gene expression, underscoring the Q(B) protein’s role in chloroplast development .

Research Applications

The recombinant protein serves as a tool for diverse studies:

ApplicationDescription
ELISA DevelopmentDetection of endogenous Q(B) protein levels in plant tissues .
Structural AnalysisCrystallization or cryo-EM studies to resolve PSII complex architecture .
Herbicide ResistanceScreening for mutations conferring resistance to herbicides .
Chloroplast SignalingInvestigating NCP-mediated regulation of PhAPGs and PEP polymerase assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Angiopteris evecta (Mule's foot fern) (Polypodium evectum)
Target Names
psbA
Target Protein Sequence
MTASLERRESASLWGRFCDWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAAAAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that is subsequently used for ATP formation. PSII comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Angiopteris evecta and why are its photosynthetic proteins significant for evolutionary plant biology research?

Angiopteris evecta (Müle's foot fern or Polypodium evectum) is a gigantic fleshy-type fern belonging to the Marattiaceae family. This species represents an ancient lineage that predates flowering plants by approximately 200 million years . Its significance for photosynthetic protein research stems from its evolutionary adaptation to understory environments beneath angiosperm-dominated forest canopies during the Cretaceous period.

The study of Angiopteris evecta photosynthetic proteins offers unique insights into evolutionary adaptations to blue-light enriched conditions found beneath forest canopies. Ferns like A. evecta underwent explosive diversification during the Cretaceous period as angiosperms became dominant, developing enhanced sensitivity to blue light wavelengths that predominate in forest understories . This makes their photosynthetic apparatus particularly valuable for understanding plant adaptation to spectral light quality shifts.

Methodologically, researchers should approach A. evecta photosynthetic proteins as evolutionary intermediates between ancient and modern photosynthetic systems, employing comparative analyses with both primitive plant lineages and advanced angiosperms to reveal adaptive mechanisms.

How does the structure of chloroplastic proteins in Angiopteris evecta compare with those of model plant species?

Based on available molecular data for Angiopteris evecta, there are notable structural characteristics that distinguish its chloroplastic proteins. The ATP synthase subunit a (atpI) from A. evecta shows specific adaptations that may reflect its evolutionary history and ecological niche .

Table 1: Structural Characteristics of A. evecta ATP synthase subunit a (atpI)

FeatureA. evecta atpITypical CharacteristicsPotential Functional Significance
Protein Length248 amino acidsVariable across speciesCompact functional domain organization
Transmembrane RegionsMultiple hydrophobic regions5-6 transmembrane helicesMembrane integration within thylakoid
Conserved MotifsPresent in positions consistent with proton channel functionHighly conserved across photosynthetic organismsMaintenance of core ATP synthesis function
Unique ResiduesSeveral fern-specific substitutionsSpecies-specific variationsAdaptation to understory light conditions
Glycerol ContentHigh proportion of glycine residuesVariable across speciesFlexibility in membrane-spanning regions

The complete amino acid sequence of ATP synthase subunit a shows the following composition: MDIEQPSINVINSLYQISGVEVGQHFYLQIGNFQVHAQVLITSWVVIAILLGLSIVATRDLQTIPTGSQNFIEYVLEFIRDLTRTQIGEEEYRPWVPFIGTMFLFIFVSNWSGALFPWRIIQLPHGELAAPTNDINTTVALALLTSVAYFYAGLHKRGLSYFGKYIQPTPVLLPINILEDFTKPLSLSFRLFGNILADELVVAVLISLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYI GESMEGHH .

For experimental design, researchers should conduct detailed comparative analyses with homologous proteins from other plant lineages using structural prediction tools and alignment algorithms to identify fern-specific adaptations.

What experimental approaches can distinguish between constitutive and light-responsive expression of photosynthetic proteins in Angiopteris evecta?

To distinguish between constitutive and light-responsive expression patterns of photosynthetic proteins in A. evecta, researchers should implement controlled light exposure experiments coupled with quantitative protein and transcript analysis.

Methodological approach:

  • Controlled growth conditions experiment:

    • Cultivate A. evecta specimens under standardized conditions

    • Subject experimental groups to different light spectra (blue, UV-A, green, orange, red) with varying intensities (0.1–100 μmol m⁻² s⁻¹)

    • Maintain control groups in darkness

  • Transcript level analysis:

    • Extract RNA from tissue samples at defined time intervals

    • Perform RT-qPCR targeting photosystem transcripts

    • Conduct transcriptome sequencing to identify differentially expressed genes involved in blue-light signaling

  • Protein quantification:

    • Use western blot analysis with antibodies specific to photosystem proteins

    • Employ mass spectrometry for absolute quantification

    • Analyze post-translational modifications that may indicate light-responsive regulation

  • Functional validation:

    • Measure physiological responses such as stomatal opening

    • Assess ROS generation using fluorescent probes like H₂DCFDA

    • Correlate protein levels with physiological responses

This approach allows researchers to establish temporal relationships between light exposure, transcript abundance, protein levels, and physiological responses, effectively distinguishing between constitutive and environmentally-induced expression patterns.

What expression systems are most appropriate for producing recombinant photosynthetic proteins from Angiopteris evecta?

The selection of an appropriate expression system for recombinant A. evecta photosynthetic proteins requires careful consideration of protein complexity, post-translational modifications, and functional requirements.

Comparative analysis of expression systems:

  • Bacterial systems (E. coli):

    • Advantages: Rapid growth, high protein yield, cost-effective

    • Limitations: Lacks chloroplast-specific chaperones, potential improper folding of membrane proteins, absence of post-translational modifications

    • Optimization strategy: Use specialized strains (e.g., C41/C43), fusion tags (e.g., MBP, SUMO), and controlled induction protocols

  • Yeast systems (P. pastoris, S. cerevisiae):

    • Advantages: Eukaryotic folding machinery, moderate cost, scalability

    • Limitations: Glycosylation patterns differ from plants

    • Optimization strategy: Codon optimization, inducible promoters, selection of appropriate strain

  • Plant-based systems (N. benthamiana, C. reinhardtii):

    • Advantages: Native-like folding environment, appropriate post-translational modifications

    • Limitations: Lower yield, longer production time

    • Optimization strategy: Transient expression using viral vectors, chloroplast transformation

  • Cell-free systems:

    • Advantages: Rapid production, avoidance of toxicity issues

    • Limitations: Higher cost, limited post-translational modifications

    • Optimization strategy: Use plant-derived extracts supplemented with chaperones

For A. evecta photosynthetic proteins, a hybrid approach is recommended, where initial screening is performed in E. coli systems with subsequent validation in plant-based systems to ensure native-like structure and function. The ATP synthase subunit a (atpI) has been successfully produced as a recombinant protein with its complete sequence of 248 amino acids preserved .

How can researchers optimize purification protocols for Angiopteris evecta photosynthetic membrane proteins?

Purification of recombinant photosynthetic membrane proteins from A. evecta presents unique challenges due to their hydrophobic nature and complex structural requirements. An optimized purification protocol should address these concerns while maintaining protein integrity.

Systematic purification workflow:

  • Cell lysis and membrane isolation:

    • Use gentle mechanical disruption (e.g., French press) for bacterial systems

    • Employ buffer systems containing glycerol (25-50%) to stabilize membrane proteins

    • Utilize differential centrifugation to isolate membrane fractions

  • Detergent solubilization optimization:

    • Screen detergents systematically (mild non-ionic: DDM, LMNG; zwitterionic: CHAPS, Fos-choline)

    • Determine optimal detergent-to-protein ratio through small-scale trials

    • Monitor protein stability during solubilization using activity assays

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Ion exchange chromatography as an orthogonal step

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control assessments:

    • SDS-PAGE and western blotting for purity and identity confirmation

    • Circular dichroism spectroscopy for secondary structure evaluation

    • Functional assays to confirm activity preservation

For A. evecta ATP synthase subunit a, storage in Tris-based buffer with 50% glycerol has been demonstrated to maintain stability . Researchers should optimize buffer components based on specific protein characteristics and intended downstream applications.

What analytical methods should be employed to validate the structural integrity of purified recombinant Angiopteris evecta photosynthetic proteins?

Validating the structural integrity of purified recombinant photosynthetic proteins from A. evecta requires a multi-faceted analytical approach to ensure native-like conformation and function.

Comprehensive structural validation strategy:

  • Primary structure verification:

    • Mass spectrometry (MS) for molecular weight confirmation

    • Peptide mapping through tryptic digestion followed by LC-MS/MS

    • N-terminal sequencing to confirm correct processing

  • Secondary and tertiary structure analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Fluorescence spectroscopy to evaluate tryptophan environment

    • Differential scanning calorimetry to determine thermal stability

    • Limited proteolysis to probe folded state

  • Quaternary structure assessment:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation

    • Native PAGE analysis

  • Functional validation:

    • Electron transfer assays for photosystem components

    • ATP synthesis measurements for ATP synthase components

    • Binding assays for specific ligands or interaction partners

  • Structural homogeneity:

    • Negative stain electron microscopy

    • Single-particle cryo-electron microscopy for high-resolution structural analysis

For the ATP synthase subunit a from A. evecta, researchers should specifically validate membrane integration properties and proton channel functionality since these are crucial for its biological role . Comparison with known structures of homologous proteins can provide additional validation of structural integrity.

How can researchers assess the functional response of Angiopteris evecta photosynthetic proteins to varying light conditions?

Assessing the functional response of A. evecta photosynthetic proteins to varying light conditions requires sophisticated experimental designs that capture both rapid responses and long-term adaptations.

Experimental design framework:

  • Light response characterization:

    • Subject isolated proteins or intact systems to controlled light regimes varying in:

      • Spectral quality (blue, UV-A, green, orange, red wavelengths)

      • Intensity (0.1–100 μmol m⁻² s⁻¹)

      • Duration and patterns (continuous vs. intermittent)

  • Rapid response measurements:

    • Electron paramagnetic resonance (EPR) spectroscopy to monitor electron transfer rates

    • Time-resolved fluorescence spectroscopy to assess energy transfer kinetics

    • Monitor conformational changes using environment-sensitive probes

    • Measure reactive oxygen species (ROS) generation using H₂DCFDA fluorescence as demonstrated with A. evecta

  • Physiological correlation studies:

    • Link photosynthetic protein activity to stomatal responses

    • Monitor light-induced calcium signaling pathways

    • Assess kinetics of blue-light induced stomatal opening using epidermal peels

  • Comparative analysis:

    • Perform parallel experiments with photosynthetic proteins from model angiosperms

    • Quantify differences in response parameters between fern and angiosperm proteins

    • Establish evolutionary context through inclusion of proteins from diverse plant lineages

This approach allows researchers to identify unique features of A. evecta photosynthetic proteins that may contribute to the enhanced blue-light sensitivity observed in leptosporangiate ferns, potentially explaining their successful adaptation to angiosperm-dominated forest understories .

What experimental approaches would best resolve contradictory data regarding electron transfer rates in fern photosynthetic proteins versus those of angiosperms?

Resolving contradictory data regarding electron transfer rates in fern versus angiosperm photosynthetic proteins requires systematic implementation of complementary experimental approaches and careful control of variables.

Methodological resolution strategy:

  • Standardization of experimental conditions:

    • Establish uniform protein isolation and purification protocols

    • Normalize protein concentrations and activity measurements

    • Control environmental parameters (temperature, pH, ionic strength)

    • Ensure consistent light sources and measurement systems

  • Multi-technique validation:

    • Apply orthogonal techniques to measure electron transfer:

      • Oxygen evolution measurements

      • Chlorophyll fluorescence kinetics

      • P700 absorbance changes

      • Electron paramagnetic resonance spectroscopy

    • Correlate results across techniques to identify methodological artifacts

  • Systematic comparison framework:

    • Design side-by-side experiments with:

      • Isolated proteins from both ferns and angiosperms

      • Thylakoid membranes from both plant groups

      • Intact chloroplasts from representative species

    • Measure responses under identical conditions

  • Source of variation analysis:

    • Investigate potential sources of discrepancy:

      • Protein isoform differences

      • Lipid environment effects

      • Post-translational modifications

      • Presence of regulatory proteins

  • Statistical rigor:

    • Employ appropriate statistical methods for comparative analysis

    • Account for biological variability through sufficient replication

    • Utilize blind experimental design to minimize bias

This systematic approach allows researchers to determine whether observed differences between fern and angiosperm photosynthetic electron transfer rates represent genuine biological adaptations or methodological artifacts, providing insight into evolutionary adaptations of ferns to understory environments .

How might the study of post-translational modifications in Angiopteris evecta photosynthetic proteins reveal regulatory mechanisms unique to ferns?

Post-translational modifications (PTMs) of photosynthetic proteins represent a critical regulatory layer that may contribute to the unique adaptations of ferns like A. evecta to understory environments.

Comprehensive PTM investigation approach:

  • PTM identification and mapping:

    • Employ high-resolution mass spectrometry (MS/MS) techniques

    • Use enrichment strategies for specific modifications:

      • Phosphorylation (TiO₂, IMAC)

      • Glycosylation (lectin affinity)

      • Redox modifications (thiol-trapping)

    • Generate comprehensive PTM maps of key photosynthetic proteins

  • Light-response correlation:

    • Compare PTM profiles under varying light conditions:

      • Dark versus light adaptation

      • Different light spectra (particularly blue light)

      • Different light intensities

    • Establish temporal dynamics of PTM changes following light exposure

  • Functional significance assessment:

    • Generate recombinant proteins with site-directed mutations at PTM sites

    • Compare functional parameters between wild-type and mutant proteins

    • Reconstitute systems with modified proteins to assess physiological impact

  • Evolutionary context analysis:

    • Compare PTM patterns across plant lineages

    • Identify fern-specific modification sites

    • Correlate conserved versus lineage-specific PTMs with adaptation to different light environments

  • Regulatory network investigation:

    • Identify kinases, phosphatases, and other modifying enzymes associated with light responses

    • Assess involvement of blue-light sensing pathways, particularly cryptochrome (CRY) signaling

    • Map signaling networks connecting light perception to photosynthetic protein regulation

This systematic analysis of PTMs may reveal how ferns like A. evecta have evolved unique regulatory mechanisms for photosynthetic proteins, potentially explaining their enhanced adaptation to blue-light enriched understory environments and contributing to their Cretaceous hyperdiversification .

What molecular mechanisms might explain the enhanced blue-light sensitivity observed in leptosporangiate ferns like Angiopteris evecta?

The enhanced blue-light sensitivity observed in leptosporangiate ferns like A. evecta likely involves multiple molecular mechanisms that evolved during their adaptation to angiosperm-dominated forest understories.

Molecular mechanisms underlying enhanced blue-light sensitivity:

  • Photoreceptor adaptations:

    • Cryptochrome (CRY) diversification through gene duplication events (212.9–196.9 Ma and 164.4–151.8 Ma)

    • Structural modifications in blue-light sensing domains

    • Altered quantum efficiency of photoreceptors

    • Modified redox cycling and signaling output

  • Signal transduction optimization:

    • Enhanced expression of genes involved in blue-light signaling pathways

    • Modified interaction interfaces between photoreceptors and signaling partners

    • Accelerated signal relay components

    • Reduced signal attenuation mechanisms

  • Photosynthetic apparatus adaptations:

    • Altered protein composition of light-harvesting complexes

    • Modified electron transport chain components

    • Optimized energy distribution between photosystems

    • Enhanced photoprotection mechanisms

  • Physiological response coupling:

    • Faster stomatal response to blue light compared to ancient fern lineages and angiosperms

    • Rapid ROS signaling integration

    • More efficient calcium-dependent signaling networks

    • Enhanced metabolic adjustments to changing light conditions

Experimental evidence from comparative studies shows that members of Polypodiales (including A. evecta) demonstrate significantly faster stomatal responses to blue light than more ancient fern lineages . This enhanced sensitivity likely evolved as ferns adapted to exploiting the blue-enriched light conditions beneath angiosperm forest canopies, contributing to their Cretaceous hyperdiversification .

How can researchers design experiments to test whether photosynthetic protein adaptations in Angiopteris evecta represent convergent or divergent evolution?

Distinguishing between convergent and divergent evolution in photosynthetic protein adaptations requires careful experimental design that integrates molecular, structural, and functional analyses within a robust phylogenetic framework.

Experimental design strategy:

  • Comprehensive phylogenetic sampling:

    • Select representative species across major plant lineages:

      • Early-diverging ferns

      • Leptosporangiate ferns (including A. evecta)

      • Gymnosperms

      • Early-diverging angiosperms

      • Derived angiosperms

    • Include species from diverse light environments

  • Molecular evolution analysis:

    • Sequence targeted photosynthetic proteins across selected species

    • Identify sites under positive selection using maximum likelihood methods

    • Map selection patterns onto protein structures

    • Calculate rates of molecular evolution in different lineages

  • Structure-function relationship assessment:

    • Determine 3D structures of homologous proteins from different lineages

    • Identify structurally convergent regions despite sequence divergence

    • Focus on functional domains related to light sensitivity

    • Analyze the ATP synthase subunit a (atpI) and other key components

  • Experimental validation:

    • Create chimeric proteins exchanging domains between fern and angiosperm homologs

    • Test functional properties of wild-type and chimeric proteins

    • Measure responses to blue-light enriched conditions

    • Assess complementation in heterologous systems

  • Environmental correlation:

    • Test protein function under simulated ancestral light conditions

    • Compare performance in blue-enriched versus full-spectrum light

    • Measure fitness parameters in different light environments

This integrated approach allows researchers to determine whether similar functional adaptations in distantly related plants represent convergent solutions to similar environmental challenges or divergent evolutionary pathways from common ancestral proteins.

What methodological approaches can distinguish between photosynthetic adaptations that arose during the Cretaceous fern diversification versus more recent adaptations?

Distinguishing between ancient Cretaceous adaptations and more recent evolutionary changes in fern photosynthetic proteins requires methodological approaches that integrate molecular dating, ancestral sequence reconstruction, and functional testing.

Methodological framework:

  • Molecular clock analysis:

    • Sequence homologous photosynthetic proteins across diverse fern lineages

    • Calibrate molecular clocks using fossil constraints

    • Estimate divergence times for key adaptive mutations

    • Focus on genes with documented duplications during relevant time periods (e.g., cryptochrome genes showing duplications between 212.9–196.9 Ma and 164.4–151.8 Ma)

  • Ancestral sequence reconstruction (ASR):

    • Infer ancestral protein sequences at key nodes:

      • Pre-angiosperm emergence

      • During Cretaceous fern diversification

      • Post-Cretaceous nodes

    • Use maximum likelihood or Bayesian approaches for reconstruction

    • Estimate confidence in reconstructed sequences

  • Resurrection biology approach:

    • Synthesize reconstructed ancestral proteins

    • Express proteins in appropriate systems

    • Characterize functional properties under controlled conditions

    • Compare reconstructed proteins with extant proteins from A. evecta and other ferns

  • Mutation effect mapping:

    • Identify substitutions between ancestral and modern sequences

    • Introduce historical mutations sequentially into ancestral backgrounds

    • Test effects on protein function, particularly blue-light responses

    • Identify critical mutations that conferred enhanced adaptation

  • Ecological correlation analysis:

    • Map functional changes to ecological shifts

    • Correlate protein adaptations with geological and climatological data

    • Test protein function under simulated paleoenvironmental conditions

    • Consider the emergence of angiosperm-dominated forests as a key selection pressure

This integrative approach enables researchers to establish temporal relationships between protein adaptations and major evolutionary events, distinguishing between adaptations that facilitated the initial Cretaceous diversification of leptosporangiate ferns and subsequent refinements to their photosynthetic apparatus.

What are the most promising approaches for resolving the structure of membrane-bound photosynthetic proteins from Angiopteris evecta?

Resolving the structure of membrane-bound photosynthetic proteins from A. evecta presents significant challenges but offers valuable evolutionary insights. A multi-technique approach is necessary to achieve high-resolution structural information.

Advanced structural biology workflow:

  • Sample preparation optimization:

    • Screen detergents and membrane mimetics:

      • Conventional detergents (DDM, LMNG)

      • Nanodiscs with varied lipid compositions

      • Styrene maleic acid lipid particles (SMALPs)

      • Amphipols and peptidiscs

    • Assess protein stability in each system using functional assays

    • Optimize buffer components based on protein characteristics, such as the Tris-based buffer with 50% glycerol used for ATP synthase subunit a

  • Crystallographic approaches:

    • Vapor diffusion crystallization trials with sparse matrix screens

    • Lipidic cubic phase crystallization for membrane proteins

    • X-ray free electron laser (XFEL) methods for microcrystals

    • Serial crystallography for radiation-sensitive proteins

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for large complexes

    • Tomography for membrane-embedded proteins

    • Subtomogram averaging for repetitive structures

    • Focus on capturing different functional states

  • Integrated structural biology:

    • Nuclear magnetic resonance (NMR) for dynamic regions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Cross-linking mass spectrometry for interaction interfaces

  • Computational structure prediction:

    • AlphaFold2 or RoseTTAFold prediction incorporating evolutionary information

    • Molecular dynamics simulations in membrane environments

    • Integration of experimental constraints with computational models

    • Refinement against low-resolution experimental data

For the ATP synthase subunit a (atpI) from A. evecta, researchers should pay particular attention to its transmembrane regions and proton channel architecture, as these features are critical for function and likely show adaptations specific to the fern lineage .

How can site-directed mutagenesis of recombinant Angiopteris evecta photosynthetic proteins inform structure-function relationships?

Site-directed mutagenesis of recombinant A. evecta photosynthetic proteins provides a powerful approach to elucidate structure-function relationships and identify residues critical for adaptations to understory light environments.

Systematic mutagenesis strategy:

  • Target site selection:

    • Evolutionary analysis to identify:

      • Sites under positive selection in fern lineages

      • Fern-specific residues compared to other plant groups

      • Conserved sites with fern-specific substitutions

    • Structural analysis to target:

      • Active site residues

      • Protein-protein interaction interfaces

      • Membrane-spanning regions

      • Potential regulatory sites

  • Mutagenesis design:

    • Conservative substitutions to test physicochemical properties

    • Ancestral state reversions to test evolutionary hypotheses

    • Scanning mutagenesis of functional domains

    • Introduction of reporter groups for spectroscopic studies

  • Functional characterization:

    • Activity assays under varying light conditions (particularly blue light)

    • Binding studies with interaction partners

    • Stability assessments in different environmental conditions

    • Kinetic measurements to detect subtle functional changes

  • Structural impact assessment:

    • Circular dichroism spectroscopy for secondary structure changes

    • Fluorescence spectroscopy for tertiary structure perturbations

    • Hydrogen-deuterium exchange mass spectrometry for dynamic effects

    • Limited proteolysis to probe structural integrity

For the ATP synthase subunit a (atpI) from A. evecta, researchers should focus on mutations in the transmembrane regions involved in proton translocation and in regions that may interact with other ATP synthase subunits . Comparison of mutant phenotypes with those of homologous proteins from other plant lineages can reveal adaptive modifications that contribute to fern success in understory environments.

What experimental approaches can assess the electron transfer kinetics in recombinant photosynthetic proteins from Angiopteris evecta?

Characterizing electron transfer kinetics in recombinant photosynthetic proteins from A. evecta requires sophisticated biophysical techniques capable of detecting rapid electron movement through protein complexes.

Comprehensive electron transfer kinetics analysis:

  • Time-resolved spectroscopy:

    • Ultrafast transient absorption spectroscopy (femtosecond to nanosecond)

    • Time-resolved fluorescence spectroscopy

    • Pump-probe spectroscopy with varied excitation wavelengths

    • Measurement under different light conditions, particularly blue-light

  • Electron paramagnetic resonance (EPR) techniques:

    • Continuous wave EPR for stable radical detection

    • Pulsed EPR for distance measurements

    • ENDOR and ESEEM for hyperfine interactions

    • Spin labeling of specific sites to track electron movement

  • Electrochemical approaches:

    • Protein film voltammetry

    • Potentiometric titrations

    • Mediated electrochemistry

    • Electrochemical impedance spectroscopy

  • Computational modeling:

    • Quantum mechanical calculations of electron transfer pathways

    • Marcus theory application to estimate transfer rates

    • Molecular dynamics simulations of protein dynamics during electron transfer

    • Integration of experimental data with computational models

  • Comparative analysis framework:

    • Side-by-side measurements with angiosperm homologs

    • Quantification of kinetic parameters (rate constants, activation energies)

    • Assessment under varied spectral conditions mimicking forest understory

    • Correlation with physiological responses such as blue-light induced stomatal opening

These approaches would allow researchers to determine whether the enhanced blue-light sensitivity observed in leptosporangiate ferns like A. evecta correlates with modified electron transfer kinetics in their photosynthetic proteins, potentially explaining their successful adaptation to angiosperm-dominated forest understories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.