Recombinant Anisomys imitator Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Anisomys imitator (Squirrel-toothed rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTSFHDHTLMIVFLISSLVLYIILLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function

Anisomys imitator Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain, comprising succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the active site (subunit 1), a binuclear center (BNC) consisting of heme a3 and CuB. The BNC reduces oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of Cytochrome c Oxidase Subunit 2 in the respiratory chain?

Cytochrome c oxidase subunit 2 (MT-CO2) serves as a critical component in the mitochondrial electron transport chain, functioning as the initial electron acceptor from cytochrome c. Structurally, it contains the dinuclear copper A center (CU(A)) that mediates electron transfer from reduced cytochrome c in the intermembrane space to the active site in subunit 1. This electron flow ultimately contributes to the reduction of molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix .

The protein participates in three key multisubunit complexes in the respiratory chain: succinate dehydrogenase (complex II), ubiquinol-cytochrome c oxidoreductase (complex III), and cytochrome c oxidase (complex IV). These complexes work cooperatively to create an electrochemical gradient across the inner mitochondrial membrane that drives ATP production through oxidative phosphorylation . This fundamental process is essential for cellular energy production across most eukaryotic organisms.

How should recombinant MT-CO2 be stored and handled to maintain optimal activity?

For optimal storage and handling of recombinant Anisomys imitator MT-CO2, researchers should follow these evidence-based protocols:

  • Storage temperature: Store the protein at -20°C for regular use. For extended storage periods, maintain at either -20°C or -80°C .

  • Buffer composition: The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized specifically for MT-CO2 stability .

  • Aliquoting: To prevent protein degradation from repeated freeze-thaw cycles, divide the stock solution into working aliquots upon receipt. Working aliquots can be stored at 4°C for up to one week .

  • Freeze-thaw management: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Handling precautions: When working with the protein, maintain cold chain management and minimize exposure to room temperature.

By adhering to these storage and handling guidelines, researchers can maximize protein stability and experimental reproducibility when working with recombinant MT-CO2.

What are the optimal conditions for using MT-CO2 in in vitro enzyme activity assays?

When designing in vitro enzyme activity assays for Anisomys imitator MT-CO2, researchers should consider several critical parameters:

  • Buffer composition: A physiologically relevant buffer system (pH 7.2-7.4) containing potassium phosphate or HEPES is typically suitable. Include stabilizing agents such as glycerol (10-20%) to maintain protein integrity.

  • Temperature control: Most cytochrome c oxidase activity assays are conducted at 25-30°C, though temperature should be optimized based on the specific experimental question. Temperature sensitivity studies can be performed by testing activity across a range from 4-40°C.

  • Substrate concentration: For electron transfer assays, reduced cytochrome c should be used at concentrations ranging from 10-50 μM to ensure enzyme saturation.

  • Activity measurement: The most widely used method for monitoring cytochrome c oxidase activity is spectrophotometric analysis of cytochrome c oxidation at 550 nm. Alternatively, oxygen consumption can be measured using oxygen electrodes.

  • Controls: Essential controls include heat-inactivated enzyme preparations and assays containing specific inhibitors like potassium cyanide or sodium azide.

Drawing from methodologies used with related cytochrome c oxidase proteins, one effective detection approach utilizes tetramethyl-p-phenylenediamine as an activity stain, which can provide a rapid and sensitive measure of functional activity .

How can researchers differentiate between functional and non-functional forms of recombinant MT-CO2?

Differentiating between functional and non-functional forms of recombinant MT-CO2 requires multiple complementary approaches:

  • Enzymatic activity assays: Measure electron transfer capacity using reduced cytochrome c as substrate. The tetramethyl-p-phenylenediamine staining method provides a reliable indicator of cytochrome c oxidase functionality . This approach can quickly distinguish between active and inactive protein preparations.

  • Spectroscopic analysis: Properly folded, functional MT-CO2 exhibits characteristic absorption spectra due to its metal cofactors. UV-visible spectroscopy can reveal whether the copper centers are properly incorporated.

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy can detect conformational differences between functional and non-functional protein forms by analyzing secondary structure elements.

  • Thermal stability analysis: Differential scanning calorimetry or thermal shift assays can identify differences in thermal stability between properly folded and misfolded protein variants.

  • Reconstitution experiments: Functional MT-CO2 should be capable of assembling with other subunits to form active cytochrome c oxidase complexes. Successful incorporation into multisubunit complexes indicates proper folding and functionality.

By combining these analytical approaches, researchers can confidently determine whether their recombinant MT-CO2 preparations retain native structure and function.

What expression systems provide optimal yields of functional MT-CO2?

The choice of expression system significantly impacts both yield and functionality of recombinant MT-CO2. Based on studies with related cytochrome c oxidase subunits:

Prokaryotic systems:

  • E. coli: While offering high expression levels, proper folding and incorporation of metal cofactors can be challenging. Consider using specialized strains with enhanced disulfide bond formation capabilities (like Origami or SHuffle).

  • Advantages: Rapid growth, high yields, cost-effective

  • Limitations: May require refolding steps, potential issues with post-translational modifications

Eukaryotic systems:

  • Saccharomyces cerevisiae: Particularly suitable for mitochondrial proteins, as demonstrated in studies with Cox2 . Yeast expression provides a more native-like environment for proper folding and assembly.

  • Insect cells: Baculovirus expression systems can produce properly folded membrane proteins with appropriate post-translational modifications.

  • Advantages: Better folding, appropriate post-translational modifications

  • Limitations: Lower yields, more complex cultivation requirements

Cell-free systems:

  • Allow precise control over the translation environment, beneficial for membrane proteins like MT-CO2

  • Advantages: Rapid production, ability to incorporate non-canonical amino acids

  • Limitations: Typically lower yields, higher cost

For optimal results with MT-CO2, yeast expression systems have shown promise for related cytochrome oxidase subunits, particularly when attempting to express functional proteins capable of assembly into respiratory complexes .

How can MT-CO2 be used to study evolutionary relationships and molecular adaptation?

Cytochrome c oxidase subunit 2 serves as an excellent molecular marker for evolutionary studies due to its essential function and unique pattern of conservation. Research strategies include:

  • Comparative sequence analysis: COII genes show significant interspecies variation despite their essential function. For example, in Tigriopus californicus, interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions, despite minimal intrapopulation variation . This pattern makes MT-CO2 valuable for population genetics and phylogenetic studies at various taxonomic levels.

  • Selection pressure analysis: Using maximum likelihood models of codon substitution (ω, the ratio of nonsynonymous to synonymous substitutions) reveals evolutionary forces acting on the gene. In T. californicus, while most COII codons show strong purifying selection (ω << 1), approximately 4% of sites evolve under relaxed selective constraint (ω = 1) .

  • Co-evolution studies: MT-CO2 interacts directly with nuclear-encoded respiratory complex subunits, creating opportunities to study mitonuclear co-evolution. This is particularly relevant when examining hybrid incompatibility between populations or closely related species .

  • Functional consequences of variation: By expressing variants of MT-CO2 in model systems, researchers can assess the functional impact of specific amino acid substitutions on enzyme activity, assembly, and respiratory efficiency.

These approaches can reveal how evolutionary forces shape this critical respiratory protein and provide insights into mechanisms of adaptation to different environments.

What methodologies are effective for studying interactions between MT-CO2 and other components of the respiratory chain?

Investigating the interactions between MT-CO2 and other respiratory chain components requires sophisticated methodologies that preserve native protein-protein interfaces. Effective approaches include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-CO2 or other respiratory chain components to isolate intact protein complexes. This approach can identify stable interaction partners but may not capture transient interactions.

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact respiratory complexes under non-denaturing conditions, allowing visualization of assembled complexes containing MT-CO2. Combined with second-dimension SDS-PAGE, it can reveal complex composition.

  • Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry analysis can map specific interaction sites between MT-CO2 and its binding partners at amino acid resolution.

  • Fluorescence Resonance Energy Transfer (FRET): By tagging MT-CO2 and potential interaction partners with appropriate fluorophores, researchers can detect interactions in real-time in living cells.

  • Genetic approaches: In yeast models, mutations in MT-CO2 can affect assembly with other subunits. For example, the W56R mutation in Cox2 impacts its biogenesis and incorporation into the cytochrome c oxidase complex . Similar genetic strategies can reveal functional interactions in various experimental systems.

  • Heterologous co-expression: Expressing MT-CO2 alongside potential interaction partners in systems like yeast can reveal assembly dependencies and functional interactions .

These complementary approaches provide a comprehensive toolkit for dissecting the complex interaction network of MT-CO2 within the respiratory chain.

What are the implications of MT-CO2 mutations for studying mitochondrial diseases?

MT-CO2 mutations provide valuable insights into mitochondrial disease mechanisms and potential therapeutic approaches:

  • Disease modeling: Specific mutations in MT-CO2 can be introduced into model systems to recapitulate aspects of mitochondrial diseases. This allows detailed study of pathophysiological mechanisms and potential therapeutic interventions.

  • Allotopic expression strategies: Research in yeast has demonstrated that cytosol-synthesized Cox2 carrying specific mutations (like W56R) can be imported into mitochondria and partially restore respiratory function in Cox2-deficient strains . This provides proof-of-principle for allotopic expression approaches, where nuclear-encoded versions of mitochondrial genes are expressed to complement mitochondrial mutations.

  • Assembly factor interactions: Mutations in MT-CO2 can disrupt interactions with assembly factors, providing insights into the complex biogenesis pathway of cytochrome c oxidase. For instance, the efficiency of Cox2 biogenesis appears to be a limiting step for successful allotopic expression .

  • Mixed populations of functional complexes: Studies indicate that when both mitochondria-encoded and cytosol-synthesized versions of Cox2 are present, both can assemble into functional complexes, though with different efficiencies . This suggests potential competition or cooperation between wild-type and mutant proteins.

  • Therapeutic development: Understanding how specific mutations affect MT-CO2 function, assembly, and stability can guide the development of targeted therapies for mitochondrial diseases associated with cytochrome c oxidase deficiencies.

These research avenues have significant implications for treating human mitochondrial diseases, as they provide foundational knowledge for developing gene therapy approaches targeting mitochondrial DNA mutations.

How can researchers overcome common challenges in MT-CO2 purification and stability?

Purifying and maintaining stable preparations of membrane proteins like MT-CO2 presents several challenges. Here are evidence-based strategies to address common issues:

  • Protein aggregation:

    • Use mild detergents suitable for membrane proteins (DDM, LMNG, or digitonin)

    • Include stabilizing agents like glycerol (10-20%) in all buffers

    • Maintain low temperatures (4°C) throughout purification

    • Consider adding specific lipids that interact with MT-CO2 in its native environment

  • Loss of cofactors:

    • Supplement buffers with appropriate metal ions (copper) to maintain the integrity of metal-binding sites

    • Avoid chelating agents like EDTA that might strip essential metal cofactors

  • Proteolytic degradation:

    • Include protease inhibitor cocktails in all purification steps

    • Minimize purification time by optimizing protocols

    • Store in conditions that minimize protease activity (e.g., with 50% glycerol at -20°C)

  • Freeze-thaw stability:

    • Avoid repeated freeze-thaw cycles as recommended for the recombinant protein

    • Store working aliquots at 4°C for up to one week to avoid freeze-thaw damage

    • For longer storage, maintain samples at -20°C or -80°C in appropriate stabilizing buffer

  • Functional assessment:

    • Regularly monitor protein activity using established assays like the tetramethyl-p-phenylenediamine staining method

    • Verify structural integrity through spectroscopic methods before proceeding with experiments

By implementing these strategies, researchers can significantly improve the yield and stability of functional MT-CO2 preparations.

What controls should be included when performing functional assays with MT-CO2?

Robust experimental design for MT-CO2 functional assays requires comprehensive controls to ensure reliable and interpretable results:

  • Positive controls:

    • Commercially available cytochrome c oxidase preparations with verified activity

    • Native mitochondrial preparations containing endogenous cytochrome c oxidase

    • These establish the expected signal range for fully functional enzyme

  • Negative controls:

    • Heat-inactivated MT-CO2 (typically 95°C for 10 minutes)

    • Samples treated with specific inhibitors:

      • Potassium cyanide (KCN)

      • Sodium azide

      • Carbon monoxide

    • These establish baseline signals representing complete inhibition

  • Substrate controls:

    • Assays without cytochrome c (substrate)

    • Varying concentrations of cytochrome c to establish dose-response relationships

    • Oxidized vs. reduced cytochrome c preparations

  • Specificity controls:

    • Related but functionally distinct proteins to verify assay specificity

    • MT-CO2 from different species to assess cross-reactivity if using antibody-based detection

  • Technical controls:

    • Samples containing all components except MT-CO2 to detect non-enzymatic reactions

    • Time-course measurements to ensure linearity within the detection range

    • Multiple technical replicates to assess reproducibility

For activity staining methods like the tetramethyl-p-phenylenediamine approach, controls should include strains with known deficiencies in cytochrome c oxidase as well as strains with defects in other respiratory complexes to confirm specificity .

How can researchers troubleshoot integration issues when incorporating MT-CO2 into liposomes or nanodiscs?

Incorporating membrane proteins like MT-CO2 into artificial membrane systems presents unique challenges. Here are methodological solutions to common issues:

  • Poor incorporation efficiency:

    • Optimize protein-to-lipid ratios through systematic testing (typical starting ranges: 1:50 to 1:200)

    • Adjust detergent concentration and removal rate during reconstitution

    • For nanodiscs, optimize MSP (membrane scaffold protein) to target protein ratios

    • Use lipid compositions that mimic the native mitochondrial inner membrane environment

  • Protein denaturation during reconstitution:

    • Maintain low temperatures throughout the reconstitution process

    • Use gentle detergent removal methods (e.g., dialysis or biobeads)

    • Include stabilizing agents like glycerol or specific lipids known to interact with MT-CO2

  • Incorrect orientation:

    • Implement freeze-thaw cycles during liposome formation to promote protein incorporation in the correct orientation

    • Use asymmetric lipid compositions that favor directional insertion

    • Verify orientation using protease protection assays or antibodies against exposed domains

  • Functional verification:

    • Develop assays that can measure MT-CO2 activity in membrane environments

    • Compare activity before and after reconstitution to quantify functional preservation

    • Use spectroscopic methods to verify structural integrity in the membrane environment

  • Size control and homogeneity:

    • For liposomes: Extrude through membranes of defined pore size

    • For nanodiscs: Carefully control MSP:lipid:protein ratios

    • Use dynamic light scattering or electron microscopy to verify size distribution

By systematically addressing these aspects, researchers can optimize reconstitution protocols specific to MT-CO2, enabling detailed structural and functional studies in controlled membrane environments.

What are the future research directions for MT-CO2 in understanding mitochondrial function and disease?

Future research on Anisomys imitator MT-CO2 and related cytochrome c oxidase subunits will likely advance along several promising avenues:

  • Comparative evolutionary studies: Further investigation of the extensive sequence variation observed between populations, as seen in model organisms like Tigriopus californicus , could provide insights into adaptive evolution of essential respiratory proteins.

  • Allotopic expression refinement: Building upon the successful allotopic expression of Cox2 in yeast models , researchers can develop improved strategies for expressing mitochondrial genes from the nucleus. This has direct applications for treating human mitochondrial diseases.

  • Structure-function relationships: Detailed mapping of how specific amino acid substitutions affect electron transfer efficiency, complex assembly, and interaction with nuclear-encoded subunits will enhance our understanding of mitochondrial respiratory function.

  • Mitonuclear interactions: Further exploration of the co-evolution between mitochondrial-encoded MT-CO2 and its nuclear-encoded interaction partners will provide insights into species barriers, hybrid incompatibility, and evolutionary constraints.

  • Therapeutic applications: Development of gene therapy approaches based on allotopic expression strategies demonstrated in model systems may eventually lead to treatments for human mitochondrial diseases caused by mutations in MT-CO2 and related genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.