Recombinant Anolis carolinensis Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Anolis carolinensis Rhodopsin (RHO)

Recombinant Anolis carolinensis rhodopsin refers to a genetically engineered version of the rhodopsin protein found in the green anole lizard, Anolis carolinensis. Rhodopsin is a crucial protein for vision, particularly in low-light conditions, and is encoded by the RHO gene. In Anolis carolinensis, rhodopsin has been detected primarily in the pineal gland, which plays a role in controlling circadian rhythms .

Function and Structure of Rhodopsin

Rhodopsin is a G-protein-coupled receptor (GPCR) that triggers visual phototransduction in rod cells. It consists of a protein component called opsin and a vitamin A-derived chromophore, 11-cis retinal. When light is absorbed, 11-cis retinal isomerizes to all-trans retinal, initiating a signaling cascade that leads to visual perception . The structure of rhodopsin includes seven transmembrane domains, with the retinal binding site located in the seventh domain .

Recombinant Rhodopsin Production

Recombinant rhodopsin is produced through genetic engineering techniques where the RHO gene from Anolis carolinensis is cloned and expressed in a suitable host system, such as bacteria or mammalian cells. This allows for the large-scale production of the protein for research and potential therapeutic applications.

Research Findings on Anolis carolinensis Rhodopsin

Studies on the rhodopsin of Anolis carolinensis have identified several amino acid substitutions unique to this species. These substitutions, such as S22N, N199H, E232A, and T319M, are located outside the transmembrane domains and may be crucial for its function in the pineal gland . The specific role of these substitutions in circadian rhythm regulation is an area of ongoing research.

Data and Tables

While specific data tables for recombinant Anolis carolinensis rhodopsin are not readily available, the following table summarizes key features of rhodopsin in general and highlights the unique aspects of Anolis carolinensis rhodopsin:

FeatureGeneral RhodopsinAnolis carolinensis Rhodopsin
LocationRod cells in retinaPrimarily in pineal gland
FunctionLow-light visionCircadian rhythm regulation
Structure7 transmembrane domainsSimilar structure with unique substitutions
Unique SubstitutionsNone notedS22N, N199H, E232A, T319M

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Anolis carolinensis (Green anole) (American chameleon)
Target Names
RHO
Target Protein Sequence
MNGTEGQNFYVPMSNKTGVVRNPFEYPQYYLADPWQFSALAAYMFLLILLGFPINFLTLF VTIQHKKLRTPLNYILLNLAVANLFMVLMGFTTTMYTSMNGYFIFGTVGCNIEGFFATLG GEMGLWSLVVLAVERYVVICKPMSNFRFGETHALIGVSCTWIMALACAGPPLLGWSRYIP EGMQCSCGVDYYTPTPEVHNESFVIYMFLVHFVTPLTIIFFCYGRLVCTVKAAAAQQQES ATTQKAEREVTRMVVIMVISFLVCWVPYASVAFYIFTHQGSDFGPVFMTIPAFFAKSSAI YNPVIYILMNKQFRNCMIMTLCCGKNPLGDEETSAGTKTETSTVSTSQVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor protein. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Pineal gland. Instead of the rod where rhodopsin is generally located.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.