Recombinant Anopheles gambiae Aquaporin AQPAn.G (AGAP008842)

Shipped with Ice Packs
In Stock

Description

Overview of AGAP008842

Recombinant Anopheles gambiae Aquaporin AQPAn.G (AGAP008842) is a full-length, His-tagged protein derived from the mosquito Anopheles gambiae. This protein belongs to the aquaporin family, which facilitates water and small solute transport across cell membranes. AGAP008842 is distinct from other aquaporins in A. gambiae, such as AgAQP1 (AGAP008843), which is primarily involved in water homeostasis and desiccation resistance .

ParameterValue
UniProt IDQ7PWV1
Gene NameAGAP008842
SynonymsAquaporin AQPAn.G
Expression HostE. coli
TagN-terminal His tag
Protein LengthFull-length (1–250 amino acids)
Purity>90% (SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Research Findings and Functional Insights

While AGAP008842’s precise role remains under investigation, proteomic studies suggest its involvement in midgut-specific functions:

  • Localization: Peptides of AGAP008842 were identified in the midgut brush-border microvilli, a region critical for nutrient absorption and ion transport .

  • Distinct Tissue Specificity: Unlike AgAQP1 (localized to stellate cells in Malpighian tubules), AGAP008842 may mediate water/solute transport in the midgut’s apical membrane .

Comparison with AgAQP1

FeatureAGAP008842AgAQP1 (AGAP008843)
Tissue ExpressionMidgut brush-border Malpighian tubules (stellate cells)
FunctionLikely nutrient/water transportWater homeostasis, desiccation resistance
Splice VariantsNot reportedTwo variants (AgAQP1A, AgAQP1B)

Applications in Research and Industry

AGAP008842 is commercially available as a recombinant protein for:

Key Challenges

  • Limited Functional Data: Unlike AgAQP1, which has been extensively studied, AGAP008842’s transport properties (e.g., Hg²⁺ sensitivity, substrate specificity) remain uncharacterized.

  • Host System Bias: Most recombinant AGAP008842 is expressed in E. coli, which may not fully replicate native post-translational modifications .

Future Directions

  1. Functional Characterization: Test AGAP008842’s water/glycerol permeability using oocyte assays.

  2. Localization Studies: Validate its brush-border localization via immunohistochemistry.

  3. Vector Control: Investigate its role in mosquito digestion or nutrient uptake as a potential target for malaria interventions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGAP008842; Aquaporin AQPAn.G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
AGAP008842
Target Protein Sequence
MTESAGVKQIVGVSDITENRNIWRMLVAEFLGTFFLVAIGIGSTTGWTDYSPTLTQIAFTFGLVVATLAQAFGHVSGCHINPAVTIGLIVTADVSILKGAFYIVSQCIGAIAGAAVIKAATPSEVVGGLGVTGIAPGLSTGQGVLIEALITFMLVFVVHGVCDNRRTDVKGSAPLAIGLSITAGHLAAIKYTGASMNPARSFGPAVVMGNYTDLWVYWVGPIVGGIVAGAVYRLFFKVRKGDEESNSYDF
Uniprot No.

Target Background

Function
Forms a water-specific channel.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Anopheles gambiae Aquaporin 1 (AgAQP1) and what is its significance in mosquito physiology?

AgAQP1 is a water-selective channel protein found in the malaria vector mosquito Anopheles gambiae that facilitates high-capacity water flow across cell membranes . The protein belongs to the larger aquaporin family found throughout nature and plays critical roles in water homeostasis during various physiological processes in the mosquito. AgAQP1 is homologous to aquaporins found in humans, Drosophila, and sap-sucking insects, indicating evolutionary conservation of these water transport mechanisms . The significance of AgAQP1 extends beyond basic water balance to adaptation mechanisms that influence vector competence, as it affects mosquito survival in varying humidity conditions and potentially impacts malaria transmission dynamics .

How are the splice variants of AgAQP1 distributed across mosquito tissues?

Research has identified two distinct splice variants of AgAQP1 with tissue-specific expression patterns:

Splice VariantPrimary Expression SitesFunctional Implication
AgAQP1AExclusively in adult female ovariesReproduction and oogenesis
AgAQP1BMidgut, Malpighian tubules, headWater homeostasis, excretion, sensory functions

AgAQP1B shows more widespread distribution throughout the mosquito body, while AgAQP1A appears specifically involved in female reproductive processes . Within the Malpighian tubules, immunolabeling studies have revealed that AgAQP1 is expressed in principal cells in the proximal portion and in stellate cells in the distal portion, suggesting specialized roles in different segments of the excretory system . The expression in Johnston's organ in the mosquito head indicates potential involvement in sensory functions related to courtship behavior .

What methods are commonly used to detect and analyze AgAQP1 expression?

Methodological approaches for analyzing AgAQP1 include:

  • Transcriptional analysis:

    • RT-PCR with specific primers for AgAQP1

    • Nested PCR for sequence confirmation

    • Northern blot analysis using labeled cDNA probes

    • Reference gene comparisons (e.g., using glyceraldehyde-3-phosphate dehydrogenase)

  • Protein detection:

    • Immunohistochemistry on paraffin sections using affinity-purified primary antibodies

    • Immunofluorescence microscopy for subcellular localization

    • Western blotting for quantitative protein analysis

  • Functional characterization:

    • Heterologous expression in Xenopus laevis oocytes

    • Osmotic water permeability measurements

    • Inhibition studies using HgCl₂ and tetraethylammonium

These complementary approaches provide comprehensive insights into both expression patterns and functional properties of AgAQP1.

What are the structural determinants of AgAQP1 water selectivity and inhibition mechanisms?

AgAQP1 exhibits structural features characteristic of water-selective aquaporins, including two signature Asn-Pro-Ala (NPA) motifs that restrict proton conductance through the channel . The protein transports water but not glycerol, confirming its classification as a water-specific aquaporin rather than an aquaglyceroporin .

Key structural elements affecting function include:

  • Tyrosine residue at position 185: Tyr185 confers sensitivity to tetraethylammonium (TEA), similar to Tyr186 in human AQP1 . Molecular modeling suggests that Tyr185 forms hydrogen bonds with nearby water molecules and Gln184, which are critical for structural stability and channel activity . TEA binding likely disrupts these hydrogen bonding interactions, explaining the inhibitory mechanism .

  • Mercury sensitivity: AgAQP1 water permeation is inhibited by HgCl₂, a characteristic shared with mammalian aquaporins . This suggests the presence of accessible cysteine residues near the water pore that react with mercury compounds.

Understanding these structural features provides opportunities for designing specific modulators of AgAQP1 function that could potentially impact mosquito water homeostasis.

How is AgAQP1 expression regulated in response to physiological and environmental challenges?

AgAQP1 expression exhibits complex regulation patterns influenced by developmental stage, sex, feeding status, and environmental conditions:

  • Developmental regulation:

    • Higher expression in adults compared to larvae or pupae

    • Sexually dimorphic expression with greater abundance in females than males

  • Feeding-dependent regulation:

    • Blood feeding significantly up-regulates AgAQP1 expression in fat body and ovary

    • Sugar feeding does not induce similar up-regulation

    • Post-blood meal expression remains elevated for several days during ovary maturation

  • Environmental adaptation:

    • Exposure to low humidity environments (42% relative humidity) reduces AgAQP1 expression

    • This down-regulation appears to be an adaptive response to desiccation stress

These regulatory patterns suggest that AgAQP1 expression is dynamically modulated to meet changing physiological demands during the mosquito life cycle and in response to environmental challenges.

What role does AgAQP1 play in mosquito desiccation resistance and survival?

Research utilizing RNA interference (RNAi) has demonstrated that AgAQP1 is directly involved in desiccation resistance . When AgAQP1 expression is reduced through RNAi:

  • Both mRNA and protein levels of AgAQP1 decrease significantly

  • Mosquitoes with reduced AgAQP1 expression survive significantly longer than controls in extremely dry environments (<20% relative humidity)

This counterintuitive finding suggests that down-regulation of AgAQP1 serves as an adaptive mechanism to reduce water loss during desiccation stress. The mechanism likely involves reducing transcellular water movement across tissues that would otherwise lead to rapid dehydration . This physiological adaptation may be particularly important for mosquito survival during dry seasons and could influence malaria transmission dynamics in regions with seasonal humidity changes.

How might recombinant AgAQP1 be utilized in functional and structural studies?

Recombinant AgAQP1 produced in expression systems such as E. coli provides valuable research tools for:

  • Structural characterization:

    • X-ray crystallography or cryo-electron microscopy to determine three-dimensional structure

    • Comparison with other insect and mammalian aquaporins to identify conserved and divergent features

  • Functional studies:

    • In vitro water transport assays using reconstituted proteoliposomes

    • High-throughput screening for inhibitor discovery

    • Site-directed mutagenesis to investigate structure-function relationships

  • Antibody production:

    • Generation of specific antibodies for immunolocalization studies

    • Development of tools to quantify protein expression levels

The availability of full-length recombinant protein with a His-tag facilitates purification and immobilization for various experimental applications. The amino acid sequence information enables precise design of mutations to probe functional domains and interaction sites.

What are the implications of AgAQP1 for malaria vector control strategies?

The critical roles of AgAQP1 in mosquito water homeostasis, reproduction, and environmental adaptation suggest several potential applications for vector control:

  • Targeted disruption of reproduction:

    • The ovary-specific expression of AgAQP1A indicates potential for developing female-specific reproductive inhibitors

    • Disruption of water transport during oogenesis could impact mosquito fecundity

  • Enhancement of desiccation susceptibility:

    • Compounds that prevent natural down-regulation of AgAQP1 during dry conditions could increase mosquito mortality in low humidity environments

    • This approach might be particularly effective during dry seasons

  • Behavioral disruption:

    • The expression of AgAQP1 in Johnston's organ suggests potential involvement in mating behavior

    • Disruption of sensory functions could impact reproduction independent of direct effects on water homeostasis

  • Surveillance applications:

    • Monitoring changes in AgAQP1 expression could serve as a biomarker for physiological status of mosquito populations

    • This information could inform timing and targeting of control interventions

By understanding the fundamental biology of AgAQP1, researchers may identify novel vulnerabilities in mosquito physiology that could be exploited for malaria vector control.

What protocols are recommended for functional characterization of recombinant AgAQP1?

Researchers investigating recombinant AgAQP1 typically employ the following experimental approaches:

  • Heterologous expression system preparation:

    • Expression of AgAQP1 cRNA in Xenopus laevis oocytes (5 ng/60 nL injection volume)

    • Incubation for 3 days in appropriate media before functional testing

    • Use of water-injected oocytes as negative controls

  • Water permeability measurements:

    • Osmotic swelling assays to determine the coefficient of osmotic water permeability (Pf)

    • Statistical analysis using Kruskal-Wallis test with Dwass procedure for pairwise comparisons

    • Data presentation as mean ± standard deviation

  • Inhibition studies:

    • Pre-incubation with HgCl₂ or tetraethylammonium at varying concentrations

    • Measurement of inhibition kinetics and dose-response relationships

    • Recovery tests after inhibitor washout to confirm specificity

  • Substrate selectivity testing:

    • Comparison of water vs. glycerol permeability coefficients

    • Use of radiolabeled substrates for precise quantification

These methodologies provide a comprehensive framework for characterizing the functional properties of recombinant AgAQP1 and can be adapted for screening potential modulators.

How can RNA interference be effectively applied to study AgAQP1 function in vivo?

RNAi has proven valuable for investigating AgAQP1 function in living mosquitoes. Key methodological considerations include:

  • dsRNA design and preparation:

    • Target a 520-bp fragment of AgAQP1 cDNA for optimal knockdown efficiency

    • Include appropriate controls (non-targeting dsRNA) to account for non-specific effects

  • Delivery method:

    • Microinjection of 400 ng dsRNA into the mosquito thorax

    • Standardize injection volume and site for consistent results

  • Validation of knockdown:

    • Assess both mRNA (RT-PCR) and protein (Western blot, immunofluorescence) levels

    • Temporal analysis to determine duration of knockdown effect

  • Physiological assessments:

    • Survival analysis under controlled humidity conditions (<20% to 42% relative humidity)

    • Water loss measurements

    • Reproductive capacity evaluation

    • Blood feeding behavior analysis

This approach has already revealed the counterintuitive finding that AgAQP1 reduction enhances desiccation resistance , demonstrating the value of functional knockdown studies in understanding the physiological roles of this water channel.

How should developmental and physiological variation in AgAQP1 expression be analyzed?

When analyzing AgAQP1 expression across different conditions, researchers should consider:

  • Normalization approaches:

    • Use of multiple reference genes (e.g., glyceraldehyde-3-phosphate dehydrogenase)

    • Tissue-specific reference selection to account for varying baseline expression

  • Statistical considerations:

    • Account for biological variability between individual mosquitoes

    • Apply appropriate statistical tests for time-series data when analyzing developmental changes

    • Consider non-parametric tests when data don't meet normality assumptions

  • Integrated analysis:

    • Correlate transcript abundance with protein levels

    • Connect expression changes with physiological outcomes

    • Consider potential post-translational regulation mechanisms

A comprehensive analytical approach helps distinguish biologically significant changes from experimental variation and provides more robust interpretations of AgAQP1 regulation.

What are the key considerations when comparing AgAQP1 with aquaporins from other species?

Comparative analysis of AgAQP1 with other aquaporins reveals important evolutionary and functional relationships. Researchers should consider:

  • Sequence alignment considerations:

    • Focus on conserved NPA motifs and channel-forming regions

    • Identify lineage-specific adaptations that may reflect ecological specialization

    • Pay particular attention to residues like Tyr185 that confer specific functional properties

  • Functional comparison parameters:

    • Water permeability coefficients under standardized conditions

    • Inhibitor sensitivity profiles

    • Substrate selectivity

  • Expression pattern comparisons:

    • Tissue distribution relative to ecological niche

    • Developmental regulation in relation to life history strategy

    • Response to environmental stressors across species

  • Phylogenetic context:

    • Consider relationships to aquaporins in humans, Drosophila, and other insects

    • Evaluate convergent evolution in water transport mechanisms

These comparative approaches can reveal how water homeostasis mechanisms have evolved in different insect vectors and may highlight conserved targets for broad-spectrum intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.