Recombinant Anopheles gambiae ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Structure

Recombinant Anopheles gambiae ATP synthase subunit a (UniProt ID: P34834) is a 226-amino-acid protein encoded by the mitochondrial gene mt:ATPase6. It is produced in E. coli with an N-terminal His-tag for purification . The protein’s structure includes:

  • Transmembrane helices: Critical for proton channel formation .

  • Conserved motifs: Walker A and B ATP-binding sites .

ParameterDetails
Molecular Weight~24.8 kDa (predicted, excluding His-tag)
Expression SystemEscherichia coli
Purification TagN-terminal His-tag
StorageLyophilized powder at -20°C or -80°C in Tris buffer with 50% glycerol

Functional Role in ATP Synthase

As part of mitochondrial complex V, subunit a enables proton translocation across the inner mitochondrial membrane, driving ATP synthesis . Key functional features include:

  • Proton channel formation: Collaborates with the c-ring to shuttle protons .

  • Rotary mechanism: Facilitates conformational changes in the F₁ domain for ATP production .

  • Pathway involvement: Central to oxidative phosphorylation, though specific pathways in Anopheles gambiae remain uncharacterized .

Genetic Context

  • Gene name: mt:ATPase6 (mitochondrially encoded) .

  • Synteny: Conserved across Plasmodium species and other insects .

Interacting Partners

Interaction TypeProteins/MoleculesRole
Structuralc-ring, subunit 8 (A6L)Stabilizes proton channel
CatalyticF₁ α₃β₃ hexamerEnergy transduction

Biochemical Studies

  • Enzyme kinetics: Used to study proton-driven ATP synthesis mechanisms .

  • Mutational analysis: Investigates impacts of mutations on ATP synthase function (e.g., m.8993T>G in humans) .

Disease Modeling

  • Mitochondrial disorders: Insights into pathologies linked to ATP6 mutations (e.g., neuropathy, ataxia) .

  • Malaria research: Potential target for disrupting mosquito mitochondrial function .

Clinical and Evolutionary Insights

  • Pathogenic mutations: Subunit a mutations in humans (e.g., aL156R) impair ATP production by >90%, causing neuropathies .

  • Evolutionary conservation: Homologs exist in Drosophila, Aedes, and Plasmodium, highlighting structural and functional preservation .

Limitations and Future Directions

  • Unresolved pathways: Specific metabolic pathways in Anopheles gambiae require further study .

  • Therapeutic potential: Structural data could inform insecticides targeting mosquito ATP synthase .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt:ATPase6; ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSTTILNLSLNWLSTFLGLFLIPVSYWLMPNRFQVIWNNILLTLHKEFKT LLGPSGHNGSTLMFISLFSLIMFNNFLGLFPYIFTSTSHLTLTLALAFPLWLSFMLYGWI NHTQHMFAHLVPQGTPPVLMPFMVCIETISNVIRPGTLAVRLTANMIAGHLLLTLLGNTG PMASNYLILSLILTTQIALLVLESAVAIIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel, potentially playing a direct role in proton translocation across the membrane.
Database Links

KEGG: aga:ATP6

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of ATP synthase subunit a (mt:ATPase6) in Anopheles gambiae?

    ATP synthase subunit a (mt:ATPase6) is a critical component of the F0 domain of the mitochondrial ATP synthase complex. In Anopheles gambiae, as in other organisms, this protein forms part of the membrane-embedded domain that facilitates proton translocation across the inner mitochondrial membrane. The F0 domain works in concert with the F1 domain to convert the energy from proton movement into ATP synthesis. The mt:ATPase6 protein specifically contains the aqueous half-channels essential for proton transport during the rotational catalysis mechanism .

    Structurally, mt:ATPase6 is encoded by the mitochondrial genome and possesses multiple transmembrane regions that anchor it within the inner mitochondrial membrane. The protein interacts directly with the c-ring subunits, allowing protons to move through the membrane and drive ATP production .

  • How does the mt:ATPase6 of Anopheles gambiae differ from that of other species?

    While the core function of ATP synthase is conserved across species, there are notable differences in the mt:ATPase6 subunit between Anopheles gambiae and other organisms:

    Speciesmt:ATPase6 CharacteristicsKey Differences
    Anopheles gambiaeFunctions in a typical F-type ATP synthaseSpecific amino acid sequence adapted to mosquito bioenergetics
    Plasmodium speciesPart of a minimally functional ATP synthase in blood stagesReduced functionality in blood stages but essential in mosquito stages
    Drosophila melanogasterSimilar structure to A. gambiaeHigher sequence homology, useful as comparative model
    Humans (MT-ATP6)Well-characterized with known disease mutationsMutations lead to mitochondrial disorders, unlike insect models

    The A. gambiae mt:ATPase6 shows adaptations specific to mosquito physiology and energy demands, which differ from mammalian systems and even from other insects. These differences may be exploited for species-specific targeting in vector control strategies .

  • What is the role of mt:ATPase6 in mosquito physiology and development?

    The mt:ATPase6 protein plays essential roles throughout mosquito development:

    • Energy metabolism: Facilitates ATP production through oxidative phosphorylation, providing energy for flight muscles, reproduction, and other energy-intensive processes

    • Mitochondrial membrane organization: Contributes to the architecture of the inner mitochondrial membrane

    • Metabolic adaptation: Helps mosquitoes adapt to varying energy demands during different life stages and feeding states

    • Reproduction and development: Supports energy requirements during egg formation and larval development

    Studies have identified ATP synthase components including the subunit a in various developmental stages of Anopheles gambiae, with particularly high expression in energy-demanding tissues like flight muscles and reproductive organs .

Advanced Research Questions

  • What are the optimal methods for expression and purification of recombinant Anopheles gambiae mt:ATPase6?

    Expression and purification of recombinant mt:ATPase6 presents significant challenges due to its hydrophobic nature and mitochondrial localization. Based on protocols established for similar proteins, the following methodological approach is recommended:

    Expression Systems:

    • Yeast expression system: S. cerevisiae or Pichia pastoris are preferred for mitochondrial membrane proteins, similar to the approach used for human ATP5F1B

    • Bacterial expression: E. coli with specialized strains (C41/C43) for membrane proteins, using fusion partners to enhance solubility

    Purification Strategy:

    1. Membrane fraction isolation using differential centrifugation

    2. Solubilization with mild detergents (DDM, LMNG, or digitonin)

    3. Affinity chromatography using His-tag or other fusion tags

    4. Size exclusion chromatography for final purification

    Critical Parameters:

    • Maintaining native-like lipid environment during purification

    • Using stabilizing agents to prevent aggregation

    • Careful detergent selection to maintain protein folding and function

    • Verification of proper folding using circular dichroism or limited proteolysis

  • How can researchers design functional assays to evaluate recombinant mt:ATPase6 activity?

    Functional characterization of recombinant mt:ATPase6 requires specialized assays that can measure its contribution to ATP synthase activity:

    Reconstitution Assays:

    • Reconstitute purified protein into liposomes with other ATP synthase subunits

    • Generate artificial proton gradients using controlled buffer conditions

    • Measure ATP synthesis rates under varying conditions with luciferase-based ATP detection

    Biophysical Characterization:

    • Patch-clamp electrophysiology to measure proton conductance

    • Fluorescence-based proton flux assays using pH-sensitive dyes

    • Hydrogen/deuterium exchange mass spectrometry to evaluate conformational changes

    Integration Assays:

    • Complementation studies in yeast ATP synthase mutants

    • Integration efficiency into native A. gambiae mitochondrial membranes

    • Blue native PAGE to assess complex formation with other subunits

    The gold standard approach combines liposome reconstitution with measurement of ATP synthesis at physiologically relevant proton motive forces (90-150 mV), similar to the techniques described for archaeal ATP synthases .

  • What are the structural determinants of proton translocation in Anopheles gambiae mt:ATPase6?

    The proton translocation mechanism in mt:ATPase6 involves specific structural elements:

    Key Structural Features:

    • Half-channels: Aqueous access pathways that guide protons from the intermembrane space to the matrix

    • Essential arginine residue: Critical for interaction with the c-ring glutamate/aspartate

    • Transmembrane helices: Form the proton pathway and interface with the rotating c-ring

    • Species-specific residues: Amino acids unique to A. gambiae that may affect proton affinity or translocation rate

    Experimental Approaches to Study These Features:

    • Site-directed mutagenesis of conserved and variable residues

    • Cysteine scanning mutagenesis combined with accessibility studies

    • Molecular dynamics simulations to identify proton pathways

    • Cryo-EM structural studies of the entire ATP synthase complex

    Recent studies on other ATP synthases have revealed that specific residues in the a subunit create an environment that facilitates proton movement between half-channels while preventing proton leakage, a mechanism likely conserved in A. gambiae .

  • How does the interaction between mt:ATPase6 and other ATP synthase subunits contribute to complex assembly and function in Anopheles gambiae?

    The assembly and function of ATP synthase relies on precise interactions between mt:ATPase6 and other subunits:

    Key Interactions:

    • mt:ATPase6-c subunit interface: Critical for proton translocation and rotor function

    • Peripheral stalk connections: Stabilize the complex during rotation

    • F1 domain interface: Ensures coupling between proton movement and ATP synthesis

    Assembly Pathway:

    1. Independent assembly of F1 and F0 subcomplexes

    2. Integration of mt:ATPase6 into the membrane with assistance from assembly factors

    3. Association with the c-ring and other F0 components

    4. Docking of the F1 domain to complete the functional complex

    Methods to Study Complex Assembly:

    • Blue native PAGE to visualize assembly intermediates

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners

    • Pulse-chase experiments to track assembly kinetics

    • Crosslinking mass spectrometry to map protein-protein interfaces

    Studies in other organisms have shown that the ATP synthase forms dimers and higher-order oligomers that shape the inner mitochondrial membrane, with the a subunit playing a critical role in these supramolecular arrangements .

  • What are the implications of mt:ATPase6 in Anopheles gambiae's vectorial capacity for Plasmodium transmission?

    The mt:ATPase6 protein may influence A. gambiae's capacity to transmit Plasmodium parasites:

    Energy Requirements During Infection:

    • Plasmodium development in mosquitoes demands additional energy resources

    • ATP synthase activity may be modulated during infection to accommodate these needs

    • The energy status of the mosquito affects parasite development success

    Potential Interface with Parasite Factors:

    • During ookinete and oocyst development, Plasmodium may interact with host mitochondria

    • Plasmodium's own ATP synthase is essential for development in the mosquito stage

    • Cross-talk between parasite and vector energy metabolism may involve ATP synthase

    Research Applications:

    • Targeting mt:ATPase6 could potentially disrupt energy provision during crucial stages of parasite development

    • Comparative studies between susceptible and resistant mosquito strains may reveal differences in ATP synthase function or regulation

    • Understanding the energetic costs of parasite transmission could identify new intervention points

    Recent studies have shown that Plasmodium development in mosquitoes is highly dependent on mitochondrial function, with ATP synthase playing a critical role in both organisms during the transmission cycle .

  • How can researchers design inhibitors specific for Anopheles gambiae mt:ATPase6 for vector control?

    Developing specific inhibitors for A. gambiae mt:ATPase6 involves several strategic approaches:

    Target Site Identification:

    • Unique binding pockets not present in human ATP synthase

    • Interfaces between mt:ATPase6 and other subunits specific to insects

    • Allosteric sites that affect proton translocation

    Inhibitor Design Strategies:

    • Structure-based virtual screening against identified binding sites

    • Fragment-based drug discovery to identify initial chemical scaffolds

    • Rational design based on known ATP synthase inhibitors with modifications for specificity

    Evaluation Pipeline:

    Screening StageMethodologyKey Parameters
    Primary screeningBiochemical assays with recombinant proteinInhibition of ATP synthesis activity
    Secondary screeningMitochondrial preparationsEffect on proton gradient and ATP production
    Tertiary screeningCellular assaysMosquito cell toxicity and selectivity ratio
    In vivo testingMosquito feeding studiesMortality, fecundity, and fitness effects

    Specificity Considerations:

    • Cross-reactivity testing against human ATP synthase

    • Environmental impact assessment on non-target organisms

    • Resistance potential evaluation

    The ideal inhibitor would exploit structural differences between mosquito and human mt:ATPase6 to achieve specificity while maintaining potency against the target enzyme .

  • What are the genetic variations in mt:ATPase6 across Anopheles species and populations, and how do they affect function?

    Genetic diversity in mt:ATPase6 has important functional and evolutionary implications:

    Patterns of Variation:

    • Single nucleotide polymorphisms (SNPs) across Anopheles populations

    • Species-specific sequence differences within the Anopheles genus

    • Conserved functional domains versus variable regions

    Functional Consequences:

    • Variations in proton translocation efficiency

    • Differences in complex stability or assembly

    • Potential adaptations to environmental conditions or metabolic demands

    Research Methodologies:

    • Population genetics analysis of mt:ATPase6 sequences from diverse geographic regions

    • Site-directed mutagenesis to introduce variant residues in recombinant protein

    • Functional comparison of ATP synthase activity from different mosquito strains

    • Ecological correlation studies linking genetic variants to environmental factors

    Applications:

    • Identification of molecular markers for population studies

    • Understanding evolutionary pressures on energy metabolism genes

    • Predicting differential susceptibility to ATP synthase inhibitors

    Recent studies on mitochondrial genes in Anopheles species have revealed significant intraspecific variation that may influence vector competence and insecticide resistance, suggesting that mt:ATPase6 variants could similarly affect these important traits .

  • How does the assembly and oligomerization of ATP synthase complexes containing mt:ATPase6 contribute to mitochondrial membrane architecture in Anopheles gambiae?

    ATP synthase complexes play a dual role in energy production and membrane architecture:

    Oligomeric Arrangements:

    • Dimeric ATP synthase complexes induce membrane curvature

    • Higher-order oligomers form rows along cristae ridges

    • The a subunit (mt:ATPase6) is positioned at the dimer interface

    Contributions to Membrane Structure:

    • Formation and maintenance of cristae morphology

    • Organization of respiratory chain supercomplexes

    • Stabilization of membrane domains with specific lipid composition

    Research Approaches:

    • Cryo-electron tomography of isolated mitochondria

    • Super-resolution microscopy with subunit-specific labeling

    • Genetic manipulation of dimerization interfaces

    • Lipid-protein interaction studies using native mass spectrometry

    Studies in other organisms have shown that ATP synthase dimers form at angles of approximately 100° and create the characteristic curved shape of cristae tips, with the a subunit playing a crucial role in this arrangement. Disruption of dimerization affects both mitochondrial ultrastructure and bioenergetic efficiency, suggesting these roles are likely conserved in A. gambiae .

  • What methodologies can be used to study the role of mt:ATPase6 in insecticide resistance mechanisms in Anopheles gambiae?

    Investigating the potential role of mt:ATPase6 in insecticide resistance requires specialized approaches:

    Expression Analysis:

    • Quantitative PCR to compare mt:ATPase6 transcript levels between resistant and susceptible strains

    • Proteomic analysis of mitochondrial fractions to assess protein abundance

    • In situ hybridization to examine tissue-specific expression patterns

    Functional Studies:

    • Measurement of ATP synthase activity in mitochondria isolated from resistant versus susceptible mosquitoes

    • Assessment of mitochondrial membrane potential and ATP production in response to insecticide exposure

    • RNAi-mediated knockdown to evaluate the contribution of ATP synthase to resistance phenotypes

    Metabolic Impact Analysis:

    • Metabolomic profiling to identify changes in energy-related metabolites

    • Respirometry to measure oxygen consumption rates

    • Measurement of reactive oxygen species production and detoxification

    Genetic Association Studies:

    • Sequencing of mt:ATPase6 in diverse resistant populations

    • Identification of SNPs associated with resistance phenotypes

    • Introduction of candidate variants into susceptible backgrounds using CRISPR-based approaches

    Recent studies have suggested that mitochondrial function and energy metabolism play underappreciated roles in insecticide resistance mechanisms, potentially involving altered ATP synthase function or regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.