Recombinant Anopheles gambiae Band 7 protein AGAP004871 (AGAP004871)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AGAP004871; Band 7 protein AGAP004871
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
AGAP004871
Target Protein Sequence
MKNSLLLYAEDETNGEASTCGRILIFLSWVLVVLTMPFSLLVCFKVVQEYERAVIFRLGR LMQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNAT VSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVE RVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQL RYLQTLNTISAEKNSTIVFPLPIDILTYFMKSKEAFVPNA
Uniprot No.

Target Background

Database Links
Protein Families
Band 7/mec-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural composition of AGAP004871?

AGAP004871 is a 280-amino acid protein with a conserved band-7 domain in its central region. According to sequence data, it contains:

  • A complete amino acid sequence: MKNSLLLYAEDETNGEASTCGRILIFLSWVLVVLTMPFSLLVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVERVERVEVIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSKEAFVPNA

  • Notable regions include the transmembrane domain, a central band-7/SPFH domain, and several potential oligomerization interfaces.

What is the phylogenetic relationship between AGAP004871 and other band-7 proteins?

AGAP004871 belongs to the diverse band-7 protein family that includes stomatins, prohibitins, flotillins, and HflC/K proteins. Phylogenetic analysis reveals:

  • AGAP004871 shares homology with band-7 proteins found in Drosophila serrata (LOC110176604)

  • It contains conserved domains present in other insect band-7 proteins

  • The protein likely evolved from a common ancestor of band-7 proteins found across diverse species

  • Despite sequence conservation, the precise molecular function may differ from mammalian homologs based on specific adaptations in mosquitoes

What expression systems are optimal for producing recombinant AGAP004871?

Based on experimental data, the following systems have been successfully used:

  • Prokaryotic Expression: E. coli systems with pET-based vectors have been employed for high-yield expression, though protein solubility can be challenging

  • Eukaryotic Expression: Insect cell expression systems (Sf9, Hi5) often provide better folding and post-translational modifications

  • Cell-Free Systems: May be considered for rapid small-scale production

Recommended approach:

  • Clone the AGAP004871 coding sequence into a vector containing appropriate tags (His6, GST, etc.)

  • Express in BL21(DE3) E. coli cells with induction at lower temperatures (16-18°C)

  • Evaluate solubility and adjust expression conditions accordingly

What purification strategies yield highest purity and activity for AGAP004871?

For optimal purification outcomes:

  • Initial capture by affinity chromatography (Ni-NTA for His-tagged protein)

  • Intermediate purification by ion-exchange chromatography

  • Polishing by size-exclusion chromatography

Purification StepRecommended ConditionsExpected Results
Affinity Chromatography50 mM Tris pH 8.0, 300 mM NaCl, 20-250 mM imidazole gradient>80% purity
Ion Exchange50 mM Tris pH 8.0, 50-500 mM NaCl gradient>90% purity
Size Exclusion50 mM Tris pH 8.0, 150 mM NaCl>95% purity

Storage recommendation: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week .

How can I investigate AGAP004871 oligomerization properties?

AGAP004871, like other band-7 proteins, likely forms oligomeric structures. To study this:

  • Analytical Size Exclusion Chromatography:

    • Run purified protein on a calibrated size exclusion column

    • Compare with molecular weight standards to determine oligomeric state

  • Chemical Crosslinking:

    • Use crosslinkers like glutaraldehyde or BS3

    • Analyze by SDS-PAGE to visualize oligomers

  • Native PAGE Analysis:

    • Run protein under non-denaturing conditions

    • Compare mobility with known standards

  • Single Particle Analysis:

    • Negative stain or cryo-electron microscopy

    • This approach has successfully revealed ring structures in related band-7 proteins

  • Crystallography:

    • X-ray crystallography has been successful for mouse stomatin domains, revealing banana-shaped dimers capable of forming ring structures

What methods are suitable for studying AGAP004871's membrane interactions?

Given that band-7 proteins interact with membranes and potentially create microdomains:

  • Liposome Flotation Assays:

    • Prepare liposomes with defined lipid compositions

    • Incubate with AGAP004871 and perform flotation centrifugation

    • Analyze fractions by Western blotting

  • Surface Plasmon Resonance (SPR):

    • Immobilize lipid bilayers on SPR chips

    • Measure protein binding kinetics and affinities

  • Fluorescence Microscopy with GFP-Tagged Protein:

    • Express GFP-AGAP004871 in cell lines

    • Analyze membrane localization and dynamics

  • Membrane Extraction Assays:

    • Test protein extraction with different detergents

    • Provides insights into membrane integration strength

How can transcriptomic analyses reveal AGAP004871's expression patterns in Anopheles gambiae?

RNA-Seq approaches have been valuable in understanding AGAP004871 expression:

  • Tissue-Specific Expression Profiling:

    • Extract RNA from different tissues (midgut, salivary glands, etc.)

    • Perform RNA-Seq analysis

    • Normalize using appropriate methods such as subsampling normalization

  • Developmental Stage Analysis:

    • Compare expression across life stages (larvae, pupae, adults)

    • Identify temporal regulation patterns

  • Environmental Response Studies:

    • Expose mosquitoes to different conditions (temperature, insecticide stress)

    • Measure AGAP004871 expression changes

Analysis example from related studies shows that hierarchical differential expression approaches perform better than standard DESeq2 or EdgeR for identifying meaningful expression differences .

What genomic approaches can identify genomic variations in AGAP004871 across mosquito populations?

To study population-level variations:

  • Whole Genome Sequencing:

    • Sequence multiple individuals from different populations

    • Call SNPs and analyze frequency distributions

    • Calculate FST values to detect selection signatures

  • Targeted Sequencing:

    • Design primers for AGAP004871 and surrounding regions

    • Sequence across populations to identify variations

  • Latitudinal Cline Analysis:

    • Study populations across ecological gradients

    • Correlate genetic variations with environmental factors

Studies have shown that such approaches can identify outlier loci potentially involved in local adaptation, as demonstrated in studies of Anopheles gambiae populations across latitudinal clines in Cameroon .

How does AGAP004871 compare structurally and functionally with mammalian band-7 proteins?

AGAP004871 shares common features with mammalian band-7 proteins but has distinct characteristics:

FeatureAGAP004871Mammalian Band-7 Proteins
Core DomainConserved band-7/SPFH domainConserved band-7/SPFH domain
OligomerizationLikely forms oligomersForms oligomeric rings (1.2-1.8 MDa complexes)
Membrane AssociationMembrane-associatedOften localized to specialized membrane domains
FunctionRole in mosquito physiology being investigatedFunctions in ion channel regulation, membrane organization, and protein quality control

Mammalian band-7 proteins like prohibitins form large complexes (1.2 MDa) composed of PHB1 and PHB2 units arranged as oligomeric rings of 16-20 nm diameter, associated with the mitochondrial inner membrane . AGAP004871 likely adopts similar quaternary structures.

What research techniques have been effective in elucidating functions of related band-7 proteins that could be applied to AGAP004871?

Several approaches have proven valuable in studies of related proteins:

  • Genetic Knockout/Knockdown Studies:

    • RNAi or CRISPR-based approaches in mosquitoes

    • Phenotypic analysis of metabolic, developmental, or stress-related effects

  • Proteomic Interaction Studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX)

  • Functional Complementation:

    • Express AGAP004871 in other species with band-7 protein mutants

    • Test for rescue of phenotypes

  • Mitochondrial Function Analysis:

    • If mitochondrially localized, analyze effects on respiratory chain complexes

    • Measure membrane potential, ATP production, and ROS generation

Studies in Arabidopsis have shown that band-7 proteins like AtPHBs and AtSLPs localize to mitochondria and affect respiration , suggesting similar approaches may be valuable for AGAP004871.

What is the potential role of AGAP004871 in Anopheles gambiae physiology and vector competence?

While the specific function remains under investigation, several hypotheses can be proposed:

  • Membrane Organization and Signaling:

    • May organize membrane microdomains in specific tissues

    • Could regulate signaling pathways important for mosquito physiology

  • Mitochondrial Function:

    • If localized to mitochondria (like many band-7 proteins), could affect energy metabolism

    • May impact stress responses and survival under varying environmental conditions

  • Vector Competence:

    • Potential involvement in mosquito-parasite interactions

    • May influence susceptibility to Plasmodium infection

Ecological genomics studies of Anopheles gambiae have identified genomic regions under selection across latitudinal clines, suggesting adaptation to different environments . AGAP004871 may play a role in such adaptations.

How might understanding AGAP004871 contribute to malaria control strategies?

Research on AGAP004871 could inform novel control approaches:

  • Target Identification:

    • If essential for mosquito survival or reproduction, could represent a novel insecticidal target

    • Structure-based drug design against AGAP004871

  • Genetic Control Strategies:

    • Potential target for gene drive approaches

    • Manipulation of mosquito fitness through AGAP004871 modification

  • Understanding Vector-Parasite Interactions:

    • If involved in Plasmodium development, could inform transmission-blocking strategies

Studies on band-7 proteins in other organisms suggest roles in regulating membrane protein complexes and protease activities , functions that could be exploited for vector control if conserved in AGAP004871.

What challenges might researchers face when studying AGAP004871 and how can they be addressed?

Several technical challenges may arise:

  • Protein Solubility Issues:

    • Challenge: Membrane proteins often have solubility problems

    • Solution: Test different detergents (DDM, CHAPS, etc.), optimize buffer conditions, consider fusion tags that enhance solubility

  • Functional Assays:

    • Challenge: Lack of established assays for AGAP004871

    • Solution: Develop assays based on predicted functions (membrane binding, oligomerization) or homologous proteins

  • In vivo Studies:

    • Challenge: Genetic manipulation of Anopheles gambiae

    • Solution: Utilize emerging CRISPR-Cas9 protocols optimized for mosquitoes, consider cell line models initially

  • Structural Studies:

    • Challenge: Membrane proteins are difficult for structural determination

    • Solution: Consider detergent screening, lipid nanodiscs, or cryo-EM approaches

How can researchers design experiments to investigate potential interaction partners of AGAP004871?

To identify and validate protein-protein interactions:

  • Yeast Two-Hybrid Screening:

    • Use AGAP004871 as bait against Anopheles gambiae cDNA library

    • Validate interactions with secondary assays

  • Co-Immunoprecipitation:

    • Generate antibodies against AGAP004871 or use tagged versions

    • Identify interacting proteins by mass spectrometry

    • Similar approaches have been successful with mammalian stomatin antibodies

  • Proximity Labeling:

    • Fuse AGAP004871 with BioID or APEX2

    • Express in mosquito cells or tissues

    • Identify nearby proteins through biotinylation and pulldown

  • Split-GFP Complementation:

    • Test specific candidate interactions in cell-based assays

    • Visualize interactions through fluorescence reconstitution

Based on studies of related proteins, potential interactors might include respiratory chain components, membrane proteins, or proteases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.