Recombinant Anopheles gambiae Gustatory and odorant receptor 24 (GPRgr24)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

GPRgr24 is a recombinant protein expressed in insect cell systems for functional studies. Key structural and biochemical properties include:

FeatureDetailSource
SpeciesAnopheles gambiae (African malaria mosquito)
UniProt IDQ7PYF4
Expression RegionAmino acids 1–457 (full-length protein)
SequenceMSLYFNADTMRIERSSVHEPKRNRNVFLDVKPIADDANVNVPPRQAARRNATVFNNRVGF... (457 residues)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

GPRgr24 functions as a heteromeric receptor, co-expressed with GPRgr22 in the maxillary palp, analogous to the Drosophila CO₂ receptor complex (Gr21a/Gr63a) . This co-expression is conserved across mosquito species, indicating evolutionary importance in chemosensation .

Functional Role in Chemosensation

GPRgr24 is essential for detecting CO₂, a primary cue mosquitoes use to locate human hosts. Key findings include:

  • CO₂ Detection: GPRgr24 forms a heterodimer with GPRgr22 to mediate CO₂ sensitivity, critical for malaria vector attraction .

  • Behavioral Impact: Disruption of GPRgr24 or GPRgr22 abolishes CO₂-driven attraction in Anopheles gambiae, making these receptors prime targets for vector control .

  • Ligand Specificity: Unlike odorant receptors (ORs), GRs like GPRgr24 detect non-volatile, high-concentration stimuli, including CO₂ and sugars .

Evolutionary Significance

GPRgr24 exhibits unique evolutionary patterns within the Anopheles gambiae complex:

  • Positive Selection: GPRgr24 shows signatures of positive selection in anthropophilic species like An. coluzzii and An. gambiae s.s., suggesting adaptation to human-host specialization .

  • Conservation: Despite lineage-specific expansions in GR genes, GPRgr24 remains highly conserved across mosquito species, underscoring its non-redundant role in CO₂ sensing .

  • Selective Sweeps: GPRgr24 is among 12 GRs linked to selective sweeps in coastal Anopheles populations, potentially reflecting local adaptation to environmental pressures .

Applications in Vector Control

Targeting GPRgr24 offers novel strategies for malaria prevention:

  • Blockade of CO₂ Sensing: Inhibiting GPRgr24/GPRgr22 disrupts host-seeking behavior, reducing mosquito-human contact .

  • Gene Drive Compatibility: Genomic studies highlight GPRgr24’s low recombination rates near centromeric regions, making it a stable locus for gene-editing interventions .

  • Chemical Screens: Recombinant GPRgr24 enables high-throughput screening for inhibitors that block CO₂ receptor activity .

Research Gaps and Future Directions

  • Ligand Diversity: While CO₂ is a known ligand, other potential ligands (e.g., salts, bitter compounds) remain uncharacterized .

  • Expression Dynamics: Tissue-specific expression patterns in non-chemosensory organs (e.g., ovaries) suggest unexplored roles in reproduction .

  • Cross-Species Variation: Functional divergence between Anopheles and Aedes CO₂ receptors warrants comparative studies to optimize species-specific interventions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPRgr24; AGAP001915; Gustatory and odorant receptor 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
GPRgr24
Target Protein Sequence
MSLYFNADTMRIERSSVHEPKRNRNVFLDVKPIADDANVNVPPRQAARRNATVFNNRVGF PPLTPKEAFVDAVPADQTCMVFESSKPIYLVLRAIGVLPYTRLPSGGTAFVLASPSMTYC VLFFLLLTVYIAFILLNRIEIVRTLEGRFEESVIAYLFIVNILPILIIPLMWYESRKVVS VVNGWVDFETVYRETTGRALELRLRTKAQVIAILLPILCSLSVAITHVTMVDFKLLQVIP YCVLDTITYMMGGYWYMACETLSITAKILAEDFQRALRHVGPAAKVSEYRSLWLRLSKLA RDTGFSTCYTFTFICLYLFFIITLSIYGLMSQISDGFGVKDIGLAVTAFCSVGLLFYICD EAHYASFNVRTNFQKKLLMVELSWMNTDAQTEINMFLRATEMNPSSINLGGFFDVNRTLF KSLLATMVTYLVVLLQFQISIPDEPSAMLMHSNSSHS
Uniprot No.

Target Background

Function
Gustatory receptor mediating acceptance or avoidance behavior depending on substrate. GPRgr22 and GPRgr24 collectively enable olfactory carbon dioxide chemosensation.
Database Links
Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Carbon dioxide-responsive neurons coexpress GPRgr22 and GPRgr24 in the maxillary palp, at both larval and adult life stages.

Q&A

What is the evolutionary significance of GPRgr24 in Anopheles mosquitoes?

GPRgr24 shows evidence of having experienced a selective sweep according to the DH test, suggesting its evolutionary importance in the Anopheles gambiae complex . This pattern of molecular evolution indicates strong selective pressure on this receptor, likely related to its function in carbon dioxide detection—a crucial cue for host-seeking behavior in mosquitoes.

Within the broader context of gustatory and odorant receptors in A. gambiae, molecular evolutionary studies reveal both lineage-specific gene expansions and instances of unusually high sequence conservation when compared to Drosophila melanogaster . The A. gambiae genome contains approximately 79 candidate odorant receptors and 76 putative gustatory receptors, with GPRgr24 being particularly important in the mosquito's sensory ecology .

Comparative genomic analyses suggest that certain chemosensory receptors have evolved specifically in highly anthropophilic (human-preferring) Anopheles species, though GPRgr24 appears to be under purifying selection rather than positive selection . This evolutionary pattern underscores its essential function in mosquito physiology that is likely conserved across species.

How does GPRgr24 function in mosquito host-seeking behavior?

GPRgr24, as a carbon dioxide receptor, plays a central role in the host-seeking behavior of female Anopheles gambiae mosquitoes. Carbon dioxide is a primary attractant that allows mosquitoes to locate potential hosts over long distances. The receptor's activation triggers a signaling cascade that ultimately influences the mosquito's flight patterns and host-seeking behavior .

Olfaction plays a critical role in host preference selection and blood feeding, which are integral behaviors for disease transmission by A. gambiae . GPRgr24 is part of a broader olfactory system that includes multiple odorant receptors selectively expressed in olfactory organs. These receptors work in concert with a common co-receptor subunit called Orco to detect various host odors .

Interestingly, some odorant receptors in female A. gambiae show down-regulation after blood feeding, corresponding to a period of reduced olfactory responses to human odorants . This suggests a complex regulatory system that modulates host-seeking behavior according to the mosquito's physiological state, though specific data on GPRgr24 regulation after blood feeding is not provided in the search results.

Advanced Research Methodologies

Several methodological approaches have been developed to identify compounds that can modulate odorant receptor function in A. gambiae, which can be applied to GPRgr24 research:

  • High-throughput screening platforms: These involve co-expression of GPRgr24 with Orco in cell lines, followed by luminescence-based detection systems to measure receptor activation or inhibition. The screening design typically includes two cycles of compound additions: first the test compounds, then the cognate ligands, with luminescence measurements taken after each application .

  • Structure-based virtual screening: Computational approaches utilizing homology models of GPRgr24 based on its amino acid sequence can predict potential binding sites and interactions with candidate ligands. This approach can be used to identify potential modulators for subsequent experimental validation.

  • Electrophysiological recordings: Patch-clamp or two-electrode voltage clamp recordings from cells expressing GPRgr24 and Orco can directly measure channel activity in response to potential modulators, providing detailed functional characterization.

  • Behavioral assays: Testing candidate compounds in behavioral assays with live mosquitoes can validate their effects on host-seeking behavior mediated by GPRgr24.

Research has shown that specific repellents can block the function of multiple odorant receptors in A. gambiae by inhibiting the common co-receptor subunit Orco . This suggests that targeting Orco might be an effective strategy for developing broad-spectrum repellents that affect multiple chemosensory pathways, including those mediated by GPRgr24.

How can recombinant GPRgr24 protein be optimally prepared for structural and functional studies?

Based on established protocols for recombinant GPRgr24 production, researchers should consider the following methodological guidelines for optimal protein preparation:

  • Expression system: The full-length GPRgr24 protein (amino acids 1-457) with an N-terminal His-tag can be successfully expressed in E. coli .

  • Purification approach: Standard His-tag affinity chromatography is effective for purifying the recombinant protein. The protein should reach greater than 90% purity as determined by SDS-PAGE .

  • Storage recommendations:

    • Store the purified protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • For long-term storage, add glycerol to a final concentration of 50%

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For optimal stability, add glycerol to 5-50% final concentration and aliquot for long-term storage

  • Buffer conditions:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been validated for storage

    • Tris-based buffer with 50% glycerol has also been shown to be effective

Following these methodological guidelines will ensure that the recombinant GPRgr24 protein maintains its structural integrity and functional properties for subsequent experimental applications.

How has GPRgr24 evolved within the Anopheles gambiae species complex?

The molecular evolution of GPRgr24 within the Anopheles gambiae species complex reveals important patterns relevant to vector biology. Analysis using the DH test has identified GPRgr24 as a carbon dioxide receptor that may have experienced a selective sweep . This finding suggests that this receptor has undergone significant evolutionary pressure, likely related to its crucial role in host-seeking behavior.

Within the broader context of gustatory receptors (Grs) in the Anopheles gambiae complex, researchers have identified distinct evolutionary patterns:

  • Positive selection: Sixteen Grs show evidence of positive selection using the McDonald-Kreitman test, including four putative sugar receptors and two Grs with unknown ligands that are highly expressed in chemosensory organs of either Anopheles coluzzii or Anopheles quadriannulatus .

  • Purifying selection: Twelve Grs, potentially including GPRgr24, show evidence of purifying selection using the McDonald-Kreitman test . This suggests that these receptors perform essential functions that are conserved across species.

  • Selective sweeps: Twelve Grs, explicitly including the carbon dioxide receptor Gr24 (GPRgr24), may have experienced a selective sweep according to the DH test . This pattern indicates strong recent selection that has reduced genetic variation around these loci.

Comparative genomic analyses across the Anopheles gambiae species complex have revealed both lineage-specific gene expansions and cases of unusual sequence conservation . These patterns suggest that chemosensory receptors have evolved to meet the specific ecological needs of different Anopheles species, particularly regarding host preference.

What is the relationship between GPRgr24 and similar receptors in other insect species?

Comparative analysis of GPRgr24 with similar receptors in other insect species provides insights into the evolution and function of this important receptor family. The odorant and gustatory receptor families in Anopheles gambiae show both similarities and differences when compared to those in Drosophila melanogaster, the most well-studied insect model .

Key comparative findings include:

  • Evolutionary conservation: Some receptors show unusually high sequence conservation between A. gambiae and D. melanogaster, suggesting fundamental roles in insect chemosensation that have been maintained through evolution .

  • Lineage-specific expansions: Both A. gambiae and D. melanogaster show lineage-specific expansions of certain receptor subfamilies, indicating adaptation to different ecological niches and host preferences .

  • Functional homology: Despite sequence divergence, functional studies suggest that the basic mechanisms of chemosensation are conserved across insect species, with odorant receptors functioning as heteromeric complexes with a common co-receptor (Orco) .

Specific to carbon dioxide sensation, research in various insects has shown that CO2 detection typically involves specialized gustatory receptors. In mosquitoes, these receptors are crucial for host-seeking behavior, whereas in fruit flies they may serve different ecological functions. The selective pressure on GPRgr24 in Anopheles suggests its particular importance in the mosquito's ability to locate human hosts, a key factor in its effectiveness as a disease vector .

How can understanding GPRgr24 function contribute to novel vector control strategies?

Understanding the molecular function of GPRgr24 has significant implications for developing targeted vector control strategies. As a carbon dioxide receptor, GPRgr24 plays a crucial role in host-seeking behavior, making it an attractive target for interventions aimed at disrupting mosquito-human contact and reducing disease transmission.

Several potential vector control approaches based on GPRgr24 research include:

What methodological challenges exist in translating GPRgr24 research to field applications?

Translating laboratory findings on GPRgr24 into effective field applications faces several methodological challenges that researchers must address:

  • Receptor specificity: Ensuring that interventions specifically target GPRgr24 without affecting non-target organisms requires detailed understanding of receptor structure and function across species. Cross-reactivity could lead to unintended ecological consequences.

  • Formulation stability: Compounds targeting GPRgr24 must remain stable and effective under field conditions, which may include high temperatures, humidity, and UV exposure. Laboratory-developed compounds often require extensive formulation optimization for field use.

  • Delivery mechanisms: Determining the most effective means of delivering GPRgr24-targeting compounds in the field remains challenging. Options include spatial repellents, treated surfaces, or attractant traps, each with different efficacy profiles.

  • Resistance monitoring: Methods for detecting and monitoring the development of resistance to GPRgr24-targeting interventions must be established. This requires sensitive assays to measure changes in receptor function or expression in wild mosquito populations.

  • Integration with existing methods: Protocols for effectively combining GPRgr24-based interventions with existing vector control tools need to be developed and validated. This requires field trials that assess the additive or synergistic effects of multiple control methods.

  • Scale-up considerations: Laboratory production of recombinant GPRgr24 protein for research purposes, as described in sources and , utilizes methods that may not be directly scalable for industrial applications. Alternative production systems may need to be developed for large-scale screening or application purposes.

Addressing these methodological challenges requires interdisciplinary collaboration between molecular biologists, chemical ecologists, formulation scientists, and public health experts to ensure that promising laboratory findings can be effectively translated into real-world vector control solutions.

What are the critical knowledge gaps in our understanding of GPRgr24?

Despite significant advances in understanding GPRgr24, several critical knowledge gaps remain that warrant further investigation:

  • Structural characterization: No high-resolution structural data for GPRgr24 is currently available. Understanding the three-dimensional structure would provide invaluable insights into ligand binding mechanisms and facilitate structure-based drug design approaches.

  • Signaling mechanisms: The precise intracellular signaling pathways activated by GPRgr24 upon carbon dioxide detection remain incompletely characterized. Elucidating these pathways would enhance our understanding of how sensory input is translated into behavioral output.

  • Regulatory mechanisms: Limited information exists regarding the transcriptional, translational, and post-translational regulation of GPRgr24 expression and function. Understanding these regulatory mechanisms, particularly in response to blood feeding or other physiological states, would provide insights into the dynamic nature of host-seeking behavior.

  • Interaction partners: Beyond the Orco co-receptor, potential interactions between GPRgr24 and other proteins in sensory neurons remain largely unexplored. Comprehensive interactome analysis would reveal additional components of the carbon dioxide sensing machinery.

  • Natural variation: The extent and functional significance of natural variation in GPRgr24 sequence and expression among wild mosquito populations are not well documented. Such variation could influence host preference and vector competence in different ecological contexts.

  • Physiological integration: How carbon dioxide sensing integrates with other sensory modalities (e.g., heat, humidity, and other odorants) to drive host-seeking behavior remains incompletely understood. A systems-level analysis would provide a more comprehensive view of sensory integration in mosquito behavior.

Addressing these knowledge gaps would significantly advance our understanding of GPRgr24 biology and potentially lead to novel approaches for vector control.

What emerging technologies show promise for advancing GPRgr24 research?

Several emerging technologies hold promise for advancing our understanding of GPRgr24 function and applications:

  • Cryo-electron microscopy (Cryo-EM): This technique has revolutionized structural biology of membrane proteins and could potentially reveal the three-dimensional structure of GPRgr24, especially when expressed with its co-receptor Orco. Structural insights would facilitate rational design of receptor modulators.

  • Single-cell transcriptomics: This approach could reveal cell-type specific expression patterns of GPRgr24 within the mosquito olfactory system and how these patterns change under different physiological conditions or in response to environmental stimuli.

  • CRISPR-Cas9 genome editing: Precise modification of the GPRgr24 gene in mosquitoes could enable detailed functional analysis through creation of knockout, knockdown, or reporter lines. This technology has already transformed functional genomics in other insect species.

  • Chemogenetics and optogenetics: These approaches allow for temporal control of neuronal activity and could be adapted to manipulate GPRgr24-expressing neurons in mosquitoes, providing insights into how these neurons contribute to host-seeking behavior.

  • Microfluidic systems: Advanced microfluidic devices coupled with behavioral tracking could enable high-throughput analysis of how GPRgr24 modulators affect mosquito responses to carbon dioxide and other host cues under controlled conditions.

  • Computational modeling: Machine learning and molecular dynamics simulations could predict GPRgr24-ligand interactions and guide the design of novel modulators. These approaches are particularly valuable given the challenges of experimental work with membrane proteins.

  • Field-deployable sensing technologies: Development of portable biosensors incorporating recombinant GPRgr24 could potentially enable real-time monitoring of carbon dioxide-detecting compounds in the field, facilitating both research and application of GPRgr24-targeting interventions.

Integration of these emerging technologies with established research methods would significantly accelerate progress in understanding GPRgr24 biology and developing applications for vector control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.