Recombinant Anopheles gambiae Innexin shaking-B (shakB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Biochemical Properties

Recombinant shakB is produced in heterologous systems to study its function in vitro. Key parameters include:

ParameterDetailsSource
Host SystemsE. coli, yeast, baculovirus, or mammalian cells ,
Purity≥85% (SDS-PAGE validated) ,
Storage-20°C to -80°C; avoid repeated freeze-thaw cycles ,
BufferTris-based buffer (50% glycerol)

Recombinant shakB is often used in ELISA assays to detect anti-innexin antibodies or study protein-protein interactions .

Functional Roles in Anopheles gambiae

shakB is implicated in critical biological processes:

Immune Response

shakB is part of a broader innexin network in Anopheles that modulates anti-Plasmodium immunity. While another innexin (AGAP001476) directly mediates TEP1-dependent ookinete lysis , shakB’s role is less defined. Gap junctions (including shakB) may facilitate signaling between midgut epithelial cells and hemocytes during infection .

Synaptic Communication

Though studied extensively in Drosophila, shakB’s role in Anopheles synapses remains unexplored. In flies, shakB isoforms form heterotypic channels in auditory and visual circuits, enabling electrical coupling between neurons . Analogous functions in Anopheles are hypothesized but require validation.

Host-Pathogen Interactions

Recombinant shakB is used to study malaria transmission. For example:

  • Innexin Inhibition: Carbenoxolone (a gap junction inhibitor) increases Plasmodium oocyst burden, suggesting shakB-related channels regulate parasite clearance .

  • TEP1 Signaling: shakB may indirectly influence TEP1-mediated immunity by modulating intercellular signaling .

Protein-Protein Interactions

shakB’s extracellular loops are critical for channel assembly. Recombinant shakB is used to map interactions with other innexins or immune effectors .

Challenges and Future Directions

ChallengePotential SolutionSource
Limited Functional DataConduct CRISPR knockdown studies in Anopheles to map shakB’s roles. ,
Host SpecificityCompare shakB’s electrophysiological properties with Drosophila homologs. ,
Structural ComplexitySolve shakB’s crystal structure to design targeted inhibitors. ,

Comparative Analysis with Other Innexins

InnexinFunction in AnophelesRelevance to shakB
AGAP001476Directly mediates TEP1-dependent Plasmodium lysis .Complementary immune role.
AGAP006241Unrelated to anti-Plasmodium responses .Distinct pathway involvement.
Drosophila ShakBForms voltage-gated channels in synapses .Structural/functional parallels.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your desired format in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. For dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended. Our default final glycerol concentration is 50%, which serves as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please communicate it to us and we will prioritize the development of your specified tag.
Synonyms
shakB; AGAP001487; Innexin shaking-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-373
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
shakB
Target Protein Sequence
MLDIFRGLKSLVKISHVNTDSPVFRLHYSITVIILMSFSLIVTTRQYVGNPIDCVHTKDI PADVLNTYCWIHSTFALKSLFLKEVGKDVPYPGVGNSAEATAADKKIYKYYQWVCFCLFF QAILFYTPRWLWKSWEGGKIHALMMDLDIGICSEIEKKQKKKLLLDYLWDNLRYHNWWAY RYYVCEFLSLCNVIGQMFLMNRFFDGEFMTFGLDVITHMEADQEDRMDPMIYIFPRMTKC TFYKYGVSGEVERHDAICILPLNVVNEKIYIFLWFWFIILTILTTLTIFYRIIIIFSPRM RVYLLRLRFRLVRRDAIEIIVRRSKMGDWFLLYRLGENLDSIIFRDVMQDLANRLHNNQH HRVPGMKGEIQDA
Uniprot No.

Target Background

Function
This protein serves as a structural component of gap junctions at electrical synapses in distal and mid-depth levels within the lamina.
Database Links
Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Innexin shaking-B in Anopheles gambiae?

Innexin shaking-B (shakB) is a protein found in the African malaria mosquito (Anopheles gambiae) that belongs to the innexin family. Innexins form gap junction channels and non-junctional hemichannels in invertebrates, facilitating cellular communication across various physiological processes. The protein consists of 373 amino acids with a molecular structure that includes transmembrane domains characteristic of gap junction proteins . Unlike connexins found in vertebrates, innexins are the primary gap junction proteins in invertebrates, though they share functional similarities despite limited sequence homology .

What are the primary biological functions of Innexin shakB?

Based on studies of innexins across invertebrate species, Innexin shakB likely plays crucial roles in multiple physiological processes in Anopheles gambiae. While specific functions of shakB in A. gambiae require further characterization, research on related innexins suggests involvement in embryonic development, reproduction, neural function, and potentially immune responses . In Drosophila melanogaster, Shaking-B forms rectifying electrical synapses in the giant fiber system, with different isoforms required pre- and post-synaptically to establish proper neuronal communication . The protein facilitates intercellular signaling by forming channels that allow passage of small molecules and ions between adjacent cells, influencing tissue coordination and development .

Why is studying recombinant A. gambiae Innexin shakB important for malaria research?

Studying recombinant A. gambiae Innexin shakB provides critical insights into mosquito biology that may inform novel vector control strategies for malaria. Understanding the fundamental cellular communication systems in A. gambiae may reveal new targets for disrupting mosquito reproduction, development, or parasite transmission . Previous research has demonstrated that silencing innexin orthologues in A. gambiae (specifically AGAP006241) causes significant defects in gonad development, with males showing impaired spermatogenesis and females lacking follicles . These reproductive impacts suggest potential targets for vector population control. Additionally, since innexins participate in immune responses in other invertebrates, characterizing shakB may reveal its potential role in mosquito-parasite interactions, possibly identifying targets to block malaria transmission .

What expression systems are optimal for producing recombinant A. gambiae Innexin shakB?

For optimal recombinant expression of A. gambiae Innexin shakB, baculovirus-insect cell systems have demonstrated effectiveness for related invertebrate membrane proteins . This approach preserves proper protein folding and post-translational modifications essential for functional studies. Based on successful expression of other A. gambiae proteins, the methodology typically involves generating an expression construct with the shakB coding sequence (ORF AGAP001487) fused to appropriate tags (such as a hexahistidine tag) for purification purposes . The expression vector should include a signal peptide (such as honeybee mellitin) to facilitate secretion and proper processing . Sf21 or High Five insect cells infected with recombinant baculovirus carrying the shakB construct provide an effective production system . Optimization of infection parameters, including multiplicity of infection and harvest timing, is crucial for maximizing protein yield while maintaining structural integrity .

What purification strategies yield the highest purity and functional activity for recombinant shakB?

Purification of recombinant A. gambiae Innexin shakB requires a multi-step approach to achieve high purity while maintaining functional integrity. Initial capture of the protein from expression media can be accomplished via immobilized metal affinity chromatography (IMAC) using the hexahistidine tag . For membrane proteins like innexins, incorporating appropriate detergents throughout purification is critical to maintain stability and native conformation. Further purification using size exclusion chromatography helps remove aggregates and improves homogeneity . Quality control assessment should include SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity. Functional activity can be preserved by storing the purified protein in a Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles . Purification protocols used for other A. gambiae proteins have achieved up to 26,000-fold purification to near homogeneity, a benchmark that could be applied to shakB purification .

How can researchers validate the structural integrity and functionality of purified recombinant shakB?

Validating both structural integrity and functionality of purified recombinant A. gambiae Innexin shakB requires multiple complementary approaches. Structural assessment should begin with circular dichroism spectroscopy to evaluate secondary structure composition and thermal stability. Size exclusion chromatography coupled with multi-angle light scattering can verify proper oligomerization, as innexins typically form hexameric hemichannels or dodecameric gap junctions . Functional validation can include liposome dye transfer assays to assess channel formation and permeability. Electrophysiological techniques such as patch-clamp recording in reconstituted systems can characterize channel conductance properties, which for other innexins range from 250-500 pS with multiple subconductance states . Pharmacological profiling using known gap junction modulators like carbenoxolone and Brilliant Blue G, which inhibit innexons in a concentration-dependent manner, provides additional functional validation . Comparing these properties with those reported for other characterized innexins helps confirm that the recombinant protein maintains native functionality.

How can mutational analysis of recombinant shakB elucidate structure-function relationships?

Mutational analysis of recombinant A. gambiae Innexin shakB provides powerful insights into structure-function relationships of this gap junction protein. Strategic mutations in transmembrane domains, particularly in TMD1, can reveal sites critical for channel formation and gating properties, as demonstrated in Drosophila Shaking-B where tryptophan substitutions at positions H27, T31, L35, or S39 significantly altered channel characteristics . Site-directed mutagenesis targeting conserved cysteine residues in extracellular loops can determine their importance in docking between hemichannels. Additionally, modifications to the amino terminus domain should be investigated since this region participates in voltage gating and junctional rectification in related innexins . Comparative analysis between wild-type and mutant proteins using electrophysiological techniques can quantify changes in conductance, voltage sensitivity, and rectification properties. Dye transfer assays with mutant constructs can assess permeability changes to molecules of different sizes and charges. These approaches collectively provide a comprehensive understanding of how specific structural elements contribute to shakB function in cellular communication.

What are the regulatory mechanisms controlling shakB channel activity in A. gambiae?

The regulatory mechanisms controlling shakB channel activity in A. gambiae likely involve multiple factors based on studies of other innexins. Voltage-dependent gating appears to be a primary regulatory mechanism, with membrane depolarization (+20 mV or higher) triggering channel opening . Cytoplasmic calcium concentration serves as another critical regulator, with increased levels promoting channel activity . Mechanical stress represents an additional activation mechanism, suggesting potential roles in mechanosensory functions . Chemical modulators also play important roles: elevated extracellular potassium concentrations stimulate channel opening, while cytoplasmic acidification attenuates function . Lipid signaling molecules appear to have inhibitory effects, as arachidonic acid has been shown to reduce channel activity in other innexin systems . Bacterial lipopolysaccharides can also downregulate innexon function, potentially linking gap junction communication with immune responses . For research applications, precise manipulation of these factors allows controlled modulation of recombinant shakB activity in experimental systems, facilitating studies of its physiological roles and potential as a target for vector control.

How does recombinant shakB interact with other innexins to form heteromeric channels?

Recombinant A. gambiae Innexin shakB likely forms heteromeric and heterotypic channels with other innexins, creating diverse communication pathways with unique properties. These interactions can be investigated through co-expression studies combining shakB with other A. gambiae innexins, followed by co-immunoprecipitation and FRET analysis to confirm physical associations. In Drosophila, Shaking-B forms rectifying electrical synapses with different isoforms required pre- and post-synaptically (Shaking-B Neural+16 presynaptically and Shaking-B Lethal postsynaptically) . These heterotypic gap junctions exhibit asymmetric voltage gating and classical rectification properties . To characterize such interactions with A. gambiae shakB, dual patch-clamp recordings of cell pairs expressing different innexin combinations can quantify channel conductance, gating properties, and molecular selectivity. Additionally, aptamer-based approaches can be employed to specifically inhibit protein-protein interactions between shakB and other innexins, similar to techniques used to study interactions between Inx2 and Inx3 carboxyl-termini . Understanding these heteromeric interactions is crucial for comprehending the complexity of intercellular communication networks in A. gambiae and may reveal specialized functions in different tissues.

What role does shakB play in neuronal function and behavior in A. gambiae?

Based on studies of innexins in other invertebrates, shakB likely plays crucial roles in neuronal function and behavior in A. gambiae through formation of electrical synapses. In Drosophila, Shaking-B forms rectifying electrical synapses in the giant fiber system essential for escape responses and coordinated movement . Similarly, in C. elegans, innexin-based gap junctions serve as amplifiers of chemical transmission between premotor interneurons and downstream motor neurons, with disruption of electrical coupling inhibiting chemical transmission . In A. gambiae, shakB may facilitate similar rapid communication between neurons controlling flight, feeding behaviors, and responses to host cues—all critical for the mosquito's vectorial capacity. Research approaches to investigate these functions include electrophysiological characterization of neuronal coupling in shakB knockdown mosquitoes, behavioral assays examining host-seeking and blood-feeding behaviors following manipulation of shakB expression, and calcium imaging to visualize communication patterns in neural circuits. Understanding shakB's role in neuronal function could reveal targets for disrupting behaviors essential for malaria transmission.

How does shakB contribute to reproductive development in A. gambiae?

Innexins play significant roles in reproductive development across invertebrate species, suggesting shakB may have similar functions in A. gambiae. Studies in A. gambiae have shown that silencing AGAP006241 (a putative innexin orthologue) causes severe defects in gonad development, resulting in males without spermatogenesis and females lacking follicles . While the specific contribution of shakB requires direct investigation, research in other insects provides insights into potential mechanisms. In Drosophila, Inx4 mutation causes tiny gonads and sterility, while in the Mediterranean fruit fly, down-regulation of Inx5 expression results in males without sperm and females lacking mature eggs . To characterize shakB's reproductive roles, researchers should employ tissue-specific knockdown approaches followed by detailed histological analysis of gonadal development. Functional complementation studies using recombinant shakB could assess whether it rescues reproductive phenotypes in innexin-deficient models. Additionally, investigating shakB expression patterns throughout reproductive development using immunohistochemistry and in situ hybridization would provide spatial and temporal information about its activity in reproductive tissues.

What potential does shakB offer as a target for novel mosquito control strategies?

ShakB presents a promising target for novel mosquito control strategies due to its likely essential roles in neural function and reproduction in A. gambiae. Gap junction proteins like innexins mediate critical intercellular communications required for normal development, neural function, and reproduction—all processes that could be targeted for vector control . Several approaches could exploit shakB as a control target: First, small molecule screening using purified recombinant shakB could identify specific inhibitors of channel function that disrupt mosquito physiology without affecting non-target organisms. Second, RNA interference approaches targeting shakB could be developed for field application, potentially disrupting reproduction or host-seeking behaviors. Third, gene drive systems targeting shakB could spread sterility or reduced fitness traits through mosquito populations. Research priorities should include high-throughput screening assays using purified recombinant shakB to identify selective inhibitors, validation of phenotypic effects in mosquito models, and assessment of resistance development potential. When developing such strategies, researchers must consider specificity to avoid effects on beneficial insects and potential compensatory mechanisms that might limit long-term effectiveness.

How can researchers overcome solubility and stability issues with recombinant shakB?

Recombinant innexin proteins like A. gambiae shakB present significant solubility and stability challenges due to their multiple transmembrane domains. Researchers can implement several strategies to overcome these issues. First, expression construct design should focus on optimizing soluble domains or using fusion partners that enhance solubility while maintaining functional integrity. Inclusion of appropriate signal sequences, such as the honeybee mellitin signal peptide used successfully with other A. gambiae proteins, can improve proper folding and processing . For purification, a detergent screening approach is essential to identify conditions that maintain protein stability without disrupting native structure; typically, mild detergents like n-dodecyl-β-D-maltoside or digitonin are effective for gap junction proteins. Stabilization can be further enhanced by including lipids that mimic the native membrane environment during purification and storage. Buffer optimization should evaluate factors including pH (typically 7.0-8.0), ionic strength, and specific stabilizing agents such as glycerol (up to 50% as used with commercial recombinant shakB) . Storage condition assessment should include thermal stability tests and functionality assays after various freeze-thaw cycles to determine optimal preservation methods. Implementation of these approaches collectively maximizes the yield of stable, functional recombinant shakB for experimental applications.

What are the best approaches for studying shakB interactions with other proteins in A. gambiae?

Studying shakB interactions with other proteins in A. gambiae requires combining complementary approaches to capture both stable and transient interactions. Co-immunoprecipitation using antibodies against shakB or epitope-tagged recombinant versions can identify stable interaction partners when coupled with mass spectrometry for protein identification. For detecting transient or weak interactions, proximity labeling approaches such as BioID or APEX2 fused to shakB can biotinylate neighboring proteins in living cells, which can then be purified and identified. Yeast two-hybrid screening using shakB domains, particularly the cytoplasmic regions, can identify direct binding partners. To validate these interactions in a more native context, bimolecular fluorescence complementation (BiFC) in mosquito cell lines allows visualization of protein interactions in living cells. For functional characterization, electrophysiological studies of reconstituted channels combined with potential interaction partners can reveal regulatory effects on channel properties. This multi-faceted approach helps construct a comprehensive interactome map for shakB, potentially revealing novel regulatory mechanisms and signaling pathways in A. gambiae that could be exploited for vector control strategies.

How can researchers develop specific antibodies against A. gambiae shakB for immunolocalization studies?

Developing specific antibodies against A. gambiae shakB for immunolocalization studies requires careful antigen design and extensive validation. Researchers should first perform bioinformatic analysis of the shakB sequence (Q7PXN1) to identify antigenic regions with high surface probability while avoiding transmembrane domains and regions with high conservation across innexin family members, which could lead to cross-reactivity . Based on the amino acid sequence, epitopes in the intracellular loop or C-terminal domain typically make ideal targets for antibody generation. Both polyclonal antibodies raised against synthetic peptides and monoclonal antibodies against purified recombinant protein domains can be effective, with monoclonals providing higher specificity. Rigorous validation is essential and should include Western blotting against recombinant shakB and A. gambiae tissue lysates, with appropriate controls including pre-immune serum and antibody pre-adsorption tests. Cross-reactivity testing against other A. gambiae innexins is crucial to ensure specificity. For immunolocalization, optimization of fixation and permeabilization protocols is necessary, as membrane proteins often require specialized approaches. Validation of immunostaining should include comparison with mRNA expression patterns and knockout/knockdown controls. Once validated, these antibodies enable precise mapping of shakB's spatial distribution across tissues and developmental stages.

How might CRISPR/Cas9 gene editing advance functional studies of shakB in A. gambiae?

CRISPR/Cas9 gene editing offers transformative approaches for studying shakB function in A. gambiae through precise genetic manipulation. This technology enables creation of knockouts to evaluate phenotypic consequences of complete shakB loss, potentially revealing its essential roles in development, reproduction, and behavior. More sophisticated applications include generating knock-in mosquitoes expressing fluorescently tagged shakB to monitor its real-time localization and dynamics in living tissues. Domain-specific mutations can be introduced to examine structure-function relationships in vivo, particularly targeting regions implicated in channel gating or selectivity based on studies of other innexins . Conditional knockouts using tissue-specific or inducible promoters controlling Cas9 expression allow temporal and spatial regulation of shakB disruption, helping distinguish between developmental and physiological roles while avoiding potential lethality of constitutive knockouts. For applied research, CRISPR-based gene drives targeting shakB could be designed for population control strategies. Implementation of these approaches requires careful guide RNA design specific to the shakB locus (AGAP001487), optimized delivery methods for mosquito embryos, and comprehensive phenotypic analysis across developmental stages, focusing particularly on neural function and reproductive biology where innexins play crucial roles .

What comparative studies between shakB and mammalian connexins could reveal about gap junction evolution?

Comparative studies between A. gambiae shakB and mammalian connexins could provide fundamental insights into gap junction evolution despite their limited sequence homology. These studies should focus on comparing three-dimensional structures, potentially through cryo-electron microscopy of purified recombinant proteins, to identify conserved structural elements that underlie channel formation despite sequence divergence. Functional comparisons through electrophysiological characterization can reveal shared biophysical properties such as voltage gating mechanisms, ionic selectivity, and response to regulatory factors like pH and calcium . Pharmacological profiling with gap junction modulators can identify conserved binding sites and regulatory mechanisms. Domain-swapping experiments replacing regions of shakB with corresponding connexin domains can determine which elements confer specific functional properties and whether these functions are transferable between these evolutionarily distant proteins. Analysis of protein-protein interactions could reveal whether innexins and connexins interact with similar cytoskeletal or signaling proteins despite their structural differences. These comparative approaches not only illuminate evolutionary pathways of intercellular communication systems but may also identify conserved functional elements that could serve as targets for both therapeutic interventions in human disease and novel vector control strategies.

How can systems biology approaches integrate shakB function into broader signaling networks in A. gambiae?

Systems biology approaches can contextualize shakB function within broader signaling networks in A. gambiae, revealing its integrated roles in mosquito biology. Multi-omics integration combining transcriptomics, proteomics, and metabolomics data from normal and shakB-manipulated mosquitoes can identify downstream effectors and compensatory mechanisms responding to altered gap junction communication. Network analysis algorithms can place shakB within protein-protein interaction networks, revealing its position in signaling cascades and regulatory circuits. Temporal studies across developmental stages and physiological conditions (blood-feeding, mating, insecticide exposure) can capture dynamic changes in these networks. Mathematical modeling of neural circuits incorporating shakB-mediated electrical coupling can predict system-level effects of shakB modification on behaviors relevant to disease transmission. Integration with genome-wide association studies linking genetic variations to phenotypic traits might identify natural shakB polymorphisms affecting vectorial capacity. These systems-level insights could reveal emergent properties not apparent from reductionist approaches, identifying network vulnerabilities that could be targeted for vector control with potentially reduced likelihood of resistance development. Implementation requires coordinated sampling across tissues and conditions, standardized data collection protocols, and sophisticated computational integration of heterogeneous data types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.