Recombinant Anopheles gambiae Kynurenine 3-monooxygenase (kh)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kh; AGAP005948; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
kh
Target Protein Sequence
MATASDSKYKRTNTNGMQHQPLDVAIVGGGLVGSLLALHLGKKGHEVNLYEYREDIRTAE LVIGRSINLALSARGRRALAEVGLEDALLNHGIPMSGRMLHDVNGKCKIVPYDANTNQCI YSVGRKHLNEVLLNAAEKYPNIHLHFNHKLVSANLDEGNLSMVDPVTKDVKSARADLIVG CDGAYSAVRKEIVKRPRYDFSQTYIEHGYLELCIPPTAGGEFAMPHNYLHIWPRGQFMMI ALPNQDRTWTVTLFMPFTQFHSITDQGLLLDFFRQHFPDAIELIGRERLVKDFFKTKAQP LVMIKCRPYHIGAKALIIGDAAHAMVPFYGQGMNAGFEDCSVLTELFNQYGTDLARILPE FSEKRWEDAHAICDLAMYNYIEMRDLVTKRSYLLRKKLDELLFWMMPNTWVPLYNSVSFS HMRYSKCIANRAWQDKILTRVLYGASIASVAAIGGLCYRHVTMGHLERLSTRILSTFQLL KPKASV
Uniprot No.

Target Background

Function

Function: Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). This enzyme is essential for quinolinic acid synthesis.

Database Links
Protein Families
Aromatic-ring hydroxylase family, KMO subfamily
Subcellular Location
Mitochondrion. Membrane; Multi-pass membrane protein.

Q&A

What is the function of KMO in Anopheles gambiae metabolism?

KMO catalyzes the hydroxylation of kynurenine to 3-hydroxykynurenine (3-HK) in the tryptophan oxidation pathway, representing a central step in mosquito tryptophan catabolism. Unlike mammals, A. gambiae lacks kynureninase activity, making the KMO pathway the primary route for tryptophan degradation . This enzyme plays a dual role: preventing the accumulation of potentially toxic kynurenine and facilitating the production of xanthurenic acid (XA), which is more chemically stable than 3-HK . The gene encoding this enzyme in A. gambiae has been characterized, and its expression is almost ubiquitous across tissues, consistent with its physiological importance in both development and 3-HK detoxification .

How does KMO contribute to mosquito eye pigmentation?

The 3-HK produced by KMO activity serves as a direct precursor for ommochrome pigments, which are the major eye pigments in mosquitoes . During pupal and early adult stages, 3-HK is transported to the compound eyes for pigmentation . The essential role of this enzyme in eye color development is demonstrated in KMO mutants, which display white-eye phenotypes due to the absence of these pigments . The developmental expression profile of KMO reveals that the gene is downregulated during the pupal stage, likely reflecting the physiological requirement for 3-HK accumulation during compound eye development .

What are the basic biochemical properties of recombinant A. gambiae KMO?

Recombinant A. gambiae KMO is a flavin-containing enzyme that catalyzes the NADPH-dependent hydroxylation of kynurenine to 3-HK. Key properties include:

  • Structure: Dimeric pyridoxal 5′-phosphate (PLP) dependent enzyme

  • pH optimum: 7.8

  • Substrate specificity: High specificity for kynurenine

  • Cofactor preference: NADPH as the preferred reducing agent

  • Localization: Contains transmembrane domains that anchor it to the outer mitochondrial membrane

The enzyme shows comparable catalytic efficiency for both 3-HK and its immediate catabolic precursor kynurenine , distinguishing it from some other species' KMO enzymes.

How can recombinant A. gambiae KMO be efficiently expressed and purified?

Expression and purification of functional recombinant KMO present significant challenges due to transmembrane domains that render the protein insoluble in many expression systems. Current methodological approaches include:

Baculovirus/Insect Cell Expression System:

  • Provides higher yields of soluble, active recombinant KMO (approximately 10% of total soluble protein)

  • Better accommodates the hydrophobic regions near the carboxyl and N-terminal ends that function as transmembrane domains

  • The system preserves post-translational modifications critical for enzyme function

While bacterial expression has been successful for human KMO using FLAG-tagged constructs , specific expression conditions for A. gambiae KMO may differ. The current recommended approach for high-yield production suitable for structural studies involves using Spodoptera frugiperda (Sf21) cells with a baculovirus vector , potentially with truncation of the transmembrane domain to improve solubility.

What structural features of A. gambiae KMO are crucial for its catalytic activity?

The catalytic activity of A. gambiae KMO depends on several key structural elements:

  • Flavin binding domain: Essential for the oxidation-reduction reactions the enzyme catalyzes

  • NADPH binding site: Required for providing reducing equivalents during the hydroxylation reaction

  • Transmembrane domains: Located near the carboxyl end and N-terminus, anchoring the enzyme to the outer mitochondrial membrane

  • Substrate binding pocket: Confers high specificity for kynurenine

While the crystal structure specifically for A. gambiae KMO has not been detailed in the provided references, structural studies of related 3-HK transaminase from A. gambiae revealed that substrate recognition depends on key residues forming salt bridges and hydrogen bond networks with ligands . Similar structural determinants likely exist in KMO for substrate specificity and catalysis.

How do mutations in the kh gene affect enzyme function and mosquito phenotype?

Mutations in the kh gene (encoding KMO) profoundly impact both enzyme function and mosquito phenotype. In Aedes aegypti, which shares significant sequence homology with A. gambiae KMO, the white-eye mutant (kh^w) exhibits:

  • A deletion of 162 nucleotides near the 3′-end of the coding region

  • Loss of 54 amino acids that disrupts a major α-helix in the protein structure

  • Complete loss of enzymatic activity

  • White-eye phenotype due to absence of ommochrome pigments

In Anopheles stephensi, CRISPR-Cas9 knockout of the KMO gene produced XA-deficient mosquitoes with significantly reduced capacity to support Plasmodium development . The phenotypic effects of KMO mutations extend beyond eye pigmentation to impact vector competence for malaria parasites, demonstrating the multifunctional significance of this enzyme.

What is the role of A. gambiae KMO in Plasmodium development and malaria transmission?

KMO plays a critical role in malaria transmission through its position in the pathway producing xanthurenic acid (XA):

  • XA functions as a gamete-activating factor for Plasmodium parasites

  • XA triggers exflagellation and maturation of Plasmodium male gametes

  • XA activates guanylyl cyclase, which is essential for parasite development in the mosquito midgut

Experimental evidence demonstrates that knockout of the KMO gene in Anopheles stephensi results in XA-deficient mosquitoes with:

These findings establish KMO as a potential target for transmission-blocking strategies aimed at interrupting the malaria parasite life cycle within the mosquito vector .

How can KMO inhibitors be designed as potential antimalarial agents?

The design of KMO inhibitors as antimalarial agents should consider multiple mechanisms of action:

Transmission-blocking approach:

  • Target the active site of KMO to prevent 3-HK and subsequent XA production

  • Inhibit the cofactor binding sites (PLP or NADPH) to disrupt enzyme function

  • Design compounds that mimic transition states in the KMO-catalyzed reaction

Dual-action strategy:

  • Develop inhibitors that both block parasite development and act as insecticides

  • Focus on compounds that prevent 3-HK accumulation without leading to toxic intermediates

The 1,2,4-oxadiazole compounds, which have demonstrated larvicidal activity against Aedes aegypti by targeting 3-HKT, provide a potential starting point for developing KMO inhibitors . Given that A. gambiae 3-HKT shares 43% sequence similarity with its Aedes counterpart , similar chemical scaffolds may be effective against both enzymes in the pathway.

Structural knowledge from crystal studies of A. gambiae 3-HKT reveals that effective inhibitors form key interactions with the enzyme, including salt bridges with positively charged residues (like Arg-356) and hydrogen bond networks with specific amino acids . Similar binding principles may apply to KMO inhibitor design.

What are the key differences between KMO in A. gambiae and other species?

Comparative analysis reveals several important distinctions between A. gambiae KMO and its counterparts in other species:

Versus mammalian KMO:

  • Similar biochemical properties: Both prefer NADPH as reducing agent and show high substrate specificity for kynurenine

  • Different metabolic context: Mammals possess kynureninase, allowing 3-HK to be converted to 3-hydroxyanthranilic acid and eventually NAD+

  • Physiological role: In mosquitoes, KMO is essential for eye pigmentation; in mammals, it's part of NAD+ synthesis and affects neurological function

Versus other insects:

  • A. gambiae KMO shares significant sequence identity with Aedes aegypti KMO (~43% similarity)

  • Regulatory differences: Expression patterns during development differ between mosquito species

  • Functional conservation: The role in ommochrome biosynthesis appears consistent across insect species

Structural considerations:

  • A. gambiae KMO contains transmembrane domains that localize it to the outer mitochondrial membrane

  • The active site architecture likely differs from mammalian counterparts, presenting opportunities for selective inhibitor design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.