Recombinant Anopheles gambiae Protein white (w)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Anopheles gambiae Protein white

The Recombinant Anopheles gambiae Protein white (w) is a laboratory-produced version of the naturally occurring white protein found in Anopheles gambiae mosquitoes. This protein is encoded by the white gene located on the X chromosome of the mosquito genome . The recombinant form is manufactured through expression systems, typically in mammalian cells, to produce a purified version that can be used for research purposes . The white protein belongs to the ATP-binding cassette (ABC) transporter family and plays a crucial role in the transport of eye pigment precursors in the mosquito. Mutations or knockout of the white gene result in a distinctive white-eye phenotype instead of the wild-type red coloration, making it an excellent visual marker for genetic studies .

The development of recombinant versions of this protein has enabled researchers to study its structure, function, and potential applications in vector control strategies targeting the malaria-transmitting Anopheles mosquitoes. The availability of commercial recombinant preparations has facilitated research into mosquito genetics and the development of new genetic engineering techniques for vector control.

Significance in Mosquito Genetics Research

The white gene and its protein product have become invaluable tools in Anopheles gambiae research. The gene's X-linked nature makes it particularly useful as a marker for genetic modifications, as hemizygous males (with only one X chromosome) will directly express the mutant phenotype when the white gene is targeted . This characteristic has made the white gene one of the first and most frequently targeted genes in CRISPR/Cas9 mutagenesis experiments in Anopheles species. The recombinant protein itself serves as an important reagent for studying protein-protein interactions, generating antibodies, and understanding the biochemical pathways involved in pigment transport in mosquitoes.

Protein Sequence and Domain Organization

The amino acid sequence of the white protein reveals its structural organization and functional domains. The sequence begins with "MTINTDDQYGDAESKTTISSSRRYSSSSYQDQSMDDALNTTLTNDKATLIQVWKPKSYGS..." and continues through several functional domains . Analysis of the protein sequence shows that it contains characteristic ATP-binding cassette (ABC) transporter motifs, including the nucleotide-binding domains (NBDs) and transmembrane domains (TMDs) that are essential for its function in transporting pigment precursors across cell membranes.

Gene Structure and Organization

The white gene in Anopheles gambiae has a distinct intron-exon structure compared to its Drosophila counterpart. Genomic analysis has revealed that the mosquito white gene spans approximately 14 kb of genomic DNA . Different white+ alleles in the wild population show polymorphisms, including the insertion of a small transposable element in intron 3, and approximately 1% nucleotide position differences between alleles . The gene's organization has been determined through comparison of cDNA and genomic sequences, establishing an intron-exon structure that differs from the Drosophila white gene.

Function and Role in Anopheles gambiae

The white protein in Anopheles gambiae serves crucial biological functions related to pigment transport and potentially other processes in the mosquito's physiology. Understanding these functions provides insight into both basic mosquito biology and potential targets for vector control strategies.

Role in Eye Pigmentation

The primary function of the white protein in Anopheles gambiae is the transport of pigment precursors necessary for the development of the characteristic red eye color in wild-type mosquitoes . The protein facilitates the cellular uptake of pigment precursors into pigment cells in the developing eye. When the white gene is knocked out or mutated, the resulting mosquitoes develop white (unpigmented) eyes due to the inability to transport these essential pigment precursors . This visual phenotype has made the white gene an ideal target for demonstrating successful genetic modification in mosquitoes.

Potential Role in Fatty Acid Transport

Recent transcriptomic analysis suggests that the white protein in Anopheles gambiae may have additional functions beyond eye pigmentation. Research has identified the white gene (AGAP001763) as a fatty acid transporter, based on its orthology to the Drosophila melanogaster white eye gene (CG2759) . This finding suggests a broader role for the white protein in lipid metabolism and transport, potentially affecting various physiological processes in the mosquito, including cuticular hydrocarbon synthesis which is important for water retention and desiccation resistance.

Applications in Research and Genetic Engineering

The Recombinant Anopheles gambiae Protein white (w) and its encoding gene have found numerous applications in mosquito research and genetic engineering efforts, particularly in the development of new tools for vector control.

CRISPR/Cas9 Mutagenesis

The white gene has proven to be an exceptional target for CRISPR/Cas9-mediated genome editing in Anopheles mosquitoes. Researchers have achieved remarkably high rates of mutagenesis efficiency when targeting this gene . The visible phenotype change from red to white eyes provides a simple readout for successful editing, making it an ideal system for optimizing CRISPR protocols in these medically important insects. Studies have demonstrated that co-injection of Cas9 protein and sgRNAs targeting the white gene can produce mosquitoes with mosaic eyes or completely white eyes, indicating high mutation efficiency .

Different sgRNAs targeting the white gene have shown variable efficiencies, with one study reporting that AcsgRNA1 produced mosaic phenotypes in 93% of males and 87% of females, while AcsgRNA2 was less efficient (32% in males, 25% in females) . These findings have helped establish optimal conditions for CRISPR/Cas9 mutagenesis in multiple Anopheles species, including A. gambiae, A. coluzzii, A. albimanus, and A. funestus.

Transgenesis and Docking Systems

The white gene has also played a significant role in the development of transgenesis systems for Anopheles gambiae. Early transgenesis efforts utilized piggyBac transposon-based approaches, which eventually led to the development of more sophisticated docking site integration systems using phage ΦC31 integrase . These systems allow for site-directed integration of transgenes into the mosquito genome.

More recent advances have incorporated the white gene as part of RNAi constructs to study gene function. For example, researchers have developed systems where inverted repeats of the white gene intron are used in UAS responder plasmids for RNA interference studies . This approach has enabled more precise manipulation of gene expression in specific tissues or developmental stages of the mosquito.

Marker for Genetic Crosses

The X-linked nature of the white gene makes it particularly useful as a marker for genetic crosses. Since males are hemizygous (XY), they will express the white-eye phenotype when carrying a mutant allele . This property has been exploited in crossing schemes to track the inheritance of X-linked traits and to establish genetic lines with specific combinations of mutations or transgenes.

Applications in Biochemical and Immunological Studies

The commercially available recombinant white protein serves various research purposes, including:

  1. Generation of antibodies against the white protein for immunological studies

  2. Investigation of protein-protein interactions involving the white protein

  3. Functional studies of pigment transport mechanisms

  4. Structure-function analyses of ABC transporters

  5. Validation of genetic modification approaches targeting the white gene

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
w; AGAP000553; Protein white
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-695
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
w
Target Protein Sequence
MTINTDDQYGDAESKTTISSSRRYSSSSYQDQSMDDALNTTLTNDKATLIQVWKPKSYGS VKGQIPQCERLTYTWKEIDVFGEAPTDGKPREPLCTRLRNCCTRQRKDFNPRKHLLKNVT GVAKSGELLAVMGSSGAGKTTLLNALAFRSPPGVKISPNAVRALNGVPVNAEQLRARCAY VQQDDLFIPSLTTREHLLFQAMLRMGRDVPASVKQHRVQEVLQELSLVKCADTIIGAPGR IKGLSGGERKRLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVLKGMAMKGKTIILTI HQPSSELYCLFDKILLVAEGRVAFLGSPYQSAEFFSQLGIPCPPNYNPADFYVQMLAIAP AKEAECRDMIKKICDSFAVSPIAREVLETASVAGKGMDEPYMLQQVEGVGSTGYRSSWWT QFYCILWRSWLSVLKDPMLVKVRLLQTAMVATLIGSIYFGQVLDQDGVMNINGSLFLFLT NMTFQNVFAVINVFSAELPVFLREKRSRLYRVDTYFLGKTIAELPLFIAVPFVFTSITYP MIGLRTGATHYLTTLFIVTLVANVSTSFGYLISCASSSISMALSVGPPVVIPFLIFGGFF LNSASVPAYFKYLSYLSWFRYANEALLINQWSTVVDGEIACTRANVTCPRSEIILETFNF RVEDFALDIACLFALIVLFRLGALLCLWLRSRSKE
Uniprot No.

Target Background

Function
May be a component of a membrane-spanning permease system crucial for transporting pigment precursors into pigment cells that determine eye color.
Database Links
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Anopheles gambiae white (w) protein and what is its biological significance?

The white protein in Anopheles gambiae is encoded by an X-linked eye color gene that plays a critical role in eye pigmentation. It belongs to the ATP-binding cassette (ABC) transporter family, which facilitates the transport of pigment precursors into pigment cells. The functional protein is essential for normal eye coloration in the mosquito .

Methodologically, researchers studying this protein should note that despite its name suggesting a "white-eye" phenotype when mutated, some white-eyed A. gambiae strains analyzed by PCR and Southern blotting showed no detectable lesions in the white gene, suggesting the existence of other genes that can produce similar phenotypes when mutated .

How should researchers approach reconstitution and storage of Recombinant Anopheles gambiae Protein white (w)?

For optimal research outcomes when working with Recombinant Anopheles gambiae Protein white (w), follow these methodological guidelines:

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

Stability considerations: The shelf life of liquid preparations is typically 6 months at -20°C/-80°C, while lyophilized preparations maintain stability for approximately 12 months under the same storage conditions .

What structural and functional differences exist between Anopheles gambiae white gene and its Drosophila homolog?

Despite their functional similarities, comparative genomic analysis reveals significant structural differences between the white genes of these two dipteran species:

Methodologically, researchers should account for these differences when designing experiments that extrapolate findings between species or when developing transgenic constructs. The distinct intron-exon structure particularly impacts primer design for genomic PCR and expression studies .

How can researchers confirm the quality and authenticity of Recombinant Anopheles gambiae Protein white (w)?

When validating Recombinant Anopheles gambiae Protein white (w) for research applications, implement the following methodological verification steps:

  • Verify purity using SDS-PAGE (expected >85% purity)

  • Confirm identity using mass spectrometry or Western blotting with appropriate antibodies

  • Check Uniprot reference (Q27256) to validate sequence integrity

  • Verify expression system (typically mammalian cells for proper folding and post-translational modifications)

  • Assess activity using appropriate functional assays based on ATP-binding capacity

For reproducibility in research, document the product code (e.g., CSB-MP634625BZL1), tag information, and protein length (partial construct) in all experimental methods sections .

What methodological approaches are most effective for investigating the role of white protein in selective sweeps within Anopheles populations?

Investigating selective sweeps involving the white gene requires sophisticated methodological approaches that can detect ongoing selection pressures:

The partialS/HIC deep learning method has proven particularly effective for discovering selective sweeps within Anopheles populations. This approach combines multiple features of genetic variation using supervised machine learning, thereby substantially improving power, accuracy, and robustness in selective sweep detection .

Research findings indicate that A. gambiae populations show very few completed hard sweeps, with most selection events being partial and/or soft sweeps. This pattern differs from what has been observed in humans, likely due to the larger population sizes and higher levels of genetic variation maintained within Anopheles populations .

For researchers investigating this phenomenon, it's crucial to note the unexpected abundance of ongoing selective sweeps compared to completed ones. Four potential explanations have been proposed:

  • Limited detection power for sweeps completed more than a few hundred generations ago

  • Recent environmental changes induced by vector control efforts

  • Possible overdominant component in frequency dynamics of beneficial alleles

  • Competitive interference between beneficial mutations from different parts of the species range

When designing experiments in this area, researchers should incorporate temporal sampling to distinguish between these possibilities, as each would produce distinct patterns of genomic variation over time.

How can adaptive spatial sampling designs improve research on Anopheles gambiae population dynamics?

For researchers studying Anopheles gambiae populations, implementing adaptive spatial sampling designs can significantly enhance data quality while optimizing resource utilization:

A two-phase adaptive spatial sampling approach has demonstrated significant benefits for field surveillance:

Phase I methodology:

  • Delineate ecological zones relevant to Anopheles habitats

  • Employ proportional lattice with close pairs sampling to maximize spatial coverage

  • Ensure representativeness of ecological zones

  • Account for spatial dependence in mosquito counts using Poisson generalized linear mixed models

Phase II methodology:

  • Focus on high-risk areas with greatest uncertainty

  • Apply spatial adaptive sampling targeting specific criteria

  • Use information loss criteria to add new locations and remove obsolete ones

This research demonstrates important methodological trade-offs that must be considered when designing vector surveillance studies. The framework provides accurate expectations of A. gambiae spatiotemporal heterogeneity but with larger margins of uncertainty compared to initial sampling .

What are the current challenges in functional characterization of Recombinant Anopheles gambiae Protein white (w)?

Researchers working on functional characterization of the white protein face several methodological challenges:

  • Protein expression challenges:

    • Obtaining sufficient quantities of properly folded protein

    • Ensuring correct post-translational modifications

    • Maintaining the native conformation in recombinant systems

  • Structural analysis limitations:

    • Difficulties in crystallizing membrane transporters like white

    • Limited high-resolution structural data available

    • Challenges in determining protein-ligand interactions

  • Functional assay development:

    • Need for reliable in vitro transport assays

    • Difficulties in reconstituting functional membrane protein systems

    • Limited availability of known substrates for the white transporter

  • Genetic manipulation complexities:

    • Existence of non-allelic mutations producing identical phenotypes

    • Five phenotypically white-eyed strains of A. gambiae analyzed by PCR and Southern blotting showed no detectable lesions in the white gene

    • Another non-allelic X-linked mutation causing an identical white-eyed phenotype has been correlated with a structural defect in the cloned white gene

These challenges necessitate a multi-faceted approach combining molecular biology, biochemistry, and genetics techniques to fully characterize the protein's function.

How does genetic polymorphism in the white gene influence protein function across different Anopheles gambiae strains?

Genomic analysis reveals significant polymorphism in the white gene across different A. gambiae strains, with important functional implications:

Distinct white+ alleles show polymorphism for the insertion of a small transposable element in intron 3 and differ at approximately 1% of nucleotide positions. This genetic variation may influence gene expression patterns and protein functionality .

The observed polymorphism presents a methodological challenge for researchers, as different strains may exhibit varying degrees of protein function despite having the "same" gene. When designing experiments:

  • Always sequence and characterize the specific white allele in your experimental strain

  • Consider the possible regulatory effects of intronic transposable elements

  • Account for strain-specific differences when comparing experimental results

  • Use multiple strains to validate functional findings

Interestingly, phenotypically white-eyed strains may not always carry mutations in the white gene itself. This complexity suggests the involvement of additional genes in the eye pigmentation pathway, requiring comprehensive genetic screening approaches to identify all contributing factors .

What analytical methods should be used to investigate the role of white protein in insecticide resistance mechanisms?

When investigating potential connections between the white protein and insecticide resistance in Anopheles gambiae, researchers should employ these analytical approaches:

  • Gene expression analysis:

    • Compare white gene expression levels between resistant and susceptible strains using qRT-PCR

    • Perform RNA-seq to identify co-regulated genes in resistance pathways

    • Use time-course experiments to track expression changes following insecticide exposure

  • Population genomics approach:

    • Apply partialS/HIC deep learning method to identify selective sweeps that might indicate selection pressure from insecticides

    • Analyze linkage disequilibrium patterns around the white locus in resistant populations

    • Compare allele frequencies between populations with different insecticide exposure histories

  • Functional transport studies:

    • Assess whether the white protein can transport insecticide compounds or their metabolites

    • Compare transport kinetics between resistant and susceptible variants

    • Use competitive inhibition studies to identify binding interactions

  • Knockout/knockdown studies:

    • Generate CRISPR-based white gene knockouts to evaluate changes in insecticide susceptibility

    • Perform RNAi knockdown experiments followed by insecticide bioassays

    • Rescue experiments with different white alleles to identify functional variants

Current research indicates that Anopheles populations show numerous ongoing selective sweeps, which may be related to recent vector control efforts. This suggests that insecticide pressure could be driving selection at multiple loci, potentially including transporters like white that might contribute to detoxification mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.