Recombinant Anopheles gambiae Transmembrane protein 234 homolog (AGAP012180)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific format preferences. To ensure we meet your needs, please specify any format requirements when placing your order. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
AGAP012180; Transmembrane protein 234 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Anopheles gambiae (African malaria mosquito)
Target Names
AGAP012180
Target Protein Sequence
MDSPENTVPASVDIYAVLSILLVAIMWGATNPFIKRGSIGYNELKADSKLGQLWLEVRFL ITRWQYLLPLVINQLGSIVYVLTLQRTELSLTVPMANSLTFVFTAITARLLGERQSGWKI YCGMTLVILGTVICGLDKML
Uniprot No.

Target Background

Database Links
Protein Families
TMEM234 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of AGAP012180?

AGAP012180 is a transmembrane protein homolog from Anopheles gambiae with 140 amino acids. The full amino acid sequence is: MDSPENTVPASVDIYAVLSILLVAIMWGATNPFIKRGSIGYNELKADSKLGQLWLEVRFLITRWQYLLPLVINQLGSIVYVLTLQRTELSLTVPMANSLTFVFTAITARLLGERQSGWKIYCGMTLVILGTVICGLDKML . The protein is typically available as a recombinant protein with an N-terminal His tag when expressed in E. coli systems . The protein is also known as Transmembrane protein 234 homolog and has the UniProt ID A0NGI1 . As a transmembrane protein, it contains hydrophobic regions that facilitate membrane integration, which should be considered when designing experiments involving protein folding and interaction studies.

What expression systems are suitable for producing recombinant AGAP012180?

Multiple expression systems have been successfully employed for the production of recombinant AGAP012180, each with specific advantages depending on research objectives:

Expression SystemAdvantagesTypical Applications
E. coliHigh yield, cost-effective, rapid productionBasic structural studies, antibody production
YeastPost-translational modifications, proper foldingFunctional studies requiring eukaryotic processing
BaculovirusComplex eukaryotic modifications, high-level expressionStructural biology, complex protein interactions
Mammalian CellNative-like folding and modificationsFunctional assays, cell-based experiments
Cell-Free ExpressionRapid production, toxic protein expressionPreliminary studies, membrane protein analysis

The choice of expression system should be guided by the specific experimental requirements . For basic biochemical characterization, E. coli expression is often sufficient, while functional studies may benefit from eukaryotic expression systems that provide more sophisticated post-translational modifications and proper membrane protein folding.

What are the optimal storage and reconstitution conditions for recombinant AGAP012180?

For optimal stability and activity, recombinant AGAP012180 should be stored according to these guidelines:

  • The lyophilized powder form should be stored at -20°C/-80°C upon receipt .

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can cause protein degradation .

  • Working aliquots can be stored at 4°C for up to one week .

  • The recommended reconstitution protocol involves:

    • Brief centrifugation of the vial before opening to bring contents to the bottom

    • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of glycerol to a final concentration of 5-50% (50% is standard) for long-term storage at -20°C/-80°C

  • The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Maintaining proper storage conditions is critical for preserving protein structure and function, particularly for transmembrane proteins which are prone to aggregation.

What purification methods are most effective for recombinant AGAP012180?

The purification of recombinant AGAP012180 typically involves a multi-step chromatographic approach:

  • Initial Capture: Since the recombinant protein contains a His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins serves as an effective initial purification step .

  • Intermediate Purification: Following IMAC, size exclusion chromatography (SEC) is recommended to remove aggregates and further increase purity.

  • Polishing Steps: For researchers requiring higher purity (>90%), additional ion exchange chromatography may be employed depending on the isoelectric point of the recombinant construct.

  • Quality Control: The purity should be verified by SDS-PAGE, with commercial preparations typically achieving ≥85-90% purity .

  • Special Considerations: As a transmembrane protein, AGAP012180 has hydrophobic regions that can cause aggregation during purification. Addition of mild detergents (e.g., 0.1% DDM or CHAPS) to the purification buffers may improve solubility and recovery.

When designing a purification strategy, researchers should consider the downstream applications to determine the required purity level and whether the tag should be removed using specific proteases.

How can researchers verify the identity and integrity of purified AGAP012180?

Multiple complementary approaches are recommended for comprehensive verification:

  • SDS-PAGE Analysis: To assess purity and molecular weight (expect approximately 16 kDa plus the tag contribution) .

  • Western Blot: Using anti-His antibodies to confirm the presence of the tagged protein, or specific antibodies against AGAP012180 if available .

  • Mass Spectrometry:

    • MALDI-TOF for intact mass determination

    • LC-MS/MS for peptide mapping and sequence confirmation

  • Circular Dichroism (CD): To evaluate secondary structure elements expected for a transmembrane protein.

  • N-terminal Sequencing: For unambiguous identification of the protein's N-terminus.

  • Functional Assays: Where applicable, based on the known or predicted functions of the protein.

A combination of these methods provides confidence in protein identity and integrity before proceeding with downstream experimental applications.

What approaches are most effective for studying AGAP012180 interactions with Plasmodium proteins?

Based on methodologies employed in similar Anopheles-Plasmodium interaction studies, researchers should consider these approaches:

  • In Vitro Binding Assays:

    • ELISA-based binding assays similar to those used for Pfs47-mosquito receptor interactions

    • Far-Western assays where mosquito midgut homogenates are separated by SDS-PAGE under non-reducing conditions, transferred to nitrocellulose membranes, and probed with recombinant AGAP012180

  • Co-Immunoprecipitation:

    • Using anti-His antibodies to pull down the recombinant AGAP012180 along with any interacting partners from mosquito or Plasmodium extracts

    • Followed by mass spectrometry identification of binding partners

  • Surface Plasmon Resonance (SPR):

    • For quantitative measurement of binding kinetics between AGAP012180 and potential Plasmodium ligands

    • This approach can determine association/dissociation rates and binding affinities

  • Yeast Two-Hybrid or Split-Ubiquitin Systems:

    • Particularly useful for transmembrane proteins like AGAP012180

    • Allows screening of interaction partners in a cellular context

  • Microscopy-Based Approaches:

    • Immunofluorescence co-localization studies in mosquito tissues

    • Proximity ligation assays (PLA) to detect protein-protein interactions in situ

These methods have proven successful in studying interactions between Plasmodium falciparum proteins like Pfs47 and mosquito midgut proteins , suggesting they would be appropriate for investigating AGAP012180's potential role in parasite-vector interactions.

How does AGAP012180 sequence conservation compare across Anopheles species?

While the search results don't provide specific sequence conservation data for AGAP012180 across Anopheles species, we can draw insights from approaches used for similar proteins:

  • Phylogenetic Analysis Approach:

    • Similar to analyses performed for P47Rec sequences from anophelines , researchers should perform multiple sequence alignments of AGAP012180 orthologs

    • Construct phylogenetic trees to determine if sequence divergence follows anopheline speciation patterns

    • Analyze conservation of specific domains and motifs

  • Comparative Analysis Framework:

    • Based on studies of other mosquito proteins, researchers might expect:

      • Higher conservation among closely related species (e.g., within the A. gambiae complex)

      • Potentially 85-95% amino acid identity with orthologs in more distant Anopheles species

      • Conservation of functional domains, particularly transmembrane regions

  • Structure-Function Implications:

    • Highly conserved regions likely represent functionally important domains

    • Variable regions may indicate species-specific adaptations

    • Transmembrane domains often show higher conservation than extracellular or cytoplasmic regions

This type of analysis would help researchers understand the evolutionary constraints on AGAP012180 and identify functionally important regions for further investigation.

What functional assays can be designed to investigate AGAP012180's biological role?

To elucidate the biological function of AGAP012180, researchers should consider a multi-faceted approach:

  • Gene Silencing Experiments:

    • RNAi-mediated knockdown of AGAP012180 in mosquitoes

    • Analysis of resulting phenotypes, particularly focusing on:

      • Mosquito survival and development

      • Susceptibility to Plasmodium infection

      • Midgut barrier integrity

  • Transgenic Overexpression:

    • Creation of mosquito lines overexpressing AGAP012180

    • Assessment of impacts on vector competence

  • Localization Studies:

    • Immunohistochemistry to determine tissue-specific expression

    • Subcellular localization using fluorescent-tagged constructs

    • Temporal expression analysis during the mosquito life cycle and in response to blood feeding

  • Binding Partner Identification:

    • Proteomic approaches to identify proteins that interact with AGAP012180

    • Validation of interactions using co-immunoprecipitation and far-Western approaches

  • In Vitro Functional Assays:

    • If AGAP012180 has enzymatic activity, development of specific activity assays

    • Membrane incorporation studies to assess proper folding and insertion

These functional approaches would provide complementary insights into the biological roles of AGAP012180 in Anopheles biology and potentially its involvement in vector-parasite interactions.

What are the main challenges in working with recombinant transmembrane proteins like AGAP012180?

Researchers face several significant challenges when working with transmembrane proteins:

  • Solubility and Aggregation Issues:

    • Transmembrane proteins tend to aggregate due to their hydrophobic domains

    • Solution: Use of appropriate detergents (DDM, CHAPS) or lipid nanodisc technology to maintain solubility

  • Proper Folding:

    • E. coli expression systems may not provide optimal folding for transmembrane proteins

    • Solution: Consider eukaryotic expression systems (insect or mammalian cells) for complex structural studies

  • Purification Efficiency:

    • Lower yields compared to soluble proteins

    • Solution: Optimize induction conditions and extraction buffers specifically for membrane proteins

  • Functional Assessment:

    • Difficult to assess functionality outside the native membrane environment

    • Solution: Reconstitution into liposomes or nanodiscs for functional studies

  • Storage Stability:

    • Increased susceptibility to denaturation during freeze-thaw cycles

    • Solution: Addition of stabilizing agents (glycerol, trehalose) and proper aliquoting to avoid repeated freeze-thaw cycles

Understanding these challenges and implementing appropriate solutions is essential for successful experimental outcomes when working with AGAP012180 or similar transmembrane proteins.

How can researchers optimize experimental conditions for protein-protein interaction studies involving AGAP012180?

Based on approaches used for similar proteins in Anopheles-Plasmodium interaction studies:

  • Buffer Optimization:

    • Systematically test different buffer compositions (pH, salt concentration, detergents)

    • Include stabilizing agents like glycerol or trehalose

    • Consider native-like lipid environments for maintaining protein conformation

  • Control Experiments:

    • Include appropriate negative controls (unrelated transmembrane proteins)

    • Use denatured AGAP012180 as a control for non-specific binding

    • Competitive binding experiments with unlabeled protein

  • Detergent Selection:

    • Screen multiple detergents at various concentrations

    • Consider detergent micelle size and charge when designing experiments

    • Mild detergents like DDM or CHAPS often provide a good balance between solubilization and preservation of protein structure

  • Binding Conditions:

    • Optimize temperature, incubation time, and protein concentration

    • For far-Western assays, non-reducing conditions may better preserve interaction domains

  • Detection Methods:

    • Use multiple complementary detection methods (e.g., antibody-based and tag-based)

    • Consider label-free approaches like surface plasmon resonance (SPR) or bio-layer interferometry (BLI)

Carefully optimized experimental conditions are critical for obtaining reliable and reproducible results in protein-protein interaction studies, particularly for challenging transmembrane proteins like AGAP012180.

What are promising research directions for further characterization of AGAP012180?

Several promising avenues for future research emerge from current knowledge:

  • Structural Biology:

    • Determination of the three-dimensional structure using X-ray crystallography, cryo-EM, or NMR spectroscopy

    • Structure-function relationship studies through targeted mutagenesis

  • Vector-Parasite Interaction Studies:

    • Investigation of potential roles in Plasmodium falciparum infection of Anopheles mosquitoes

    • Comparison with interaction mechanisms of known proteins involved in vector competence

  • Mosquito Immunity:

    • Exploration of potential roles in immune responses against pathogens

    • Assessment of expression changes during infection

  • Comparative Genomics:

    • Comprehensive analysis of AGAP012180 orthologs across Anopheles species

    • Correlation of sequence variations with differences in vector competence

  • Therapeutic Target Potential:

    • Evaluation as a potential target for transmission-blocking strategies

    • Development of small molecule inhibitors or antibodies targeting AGAP012180

These research directions would contribute to a deeper understanding of Anopheles biology and potentially reveal new targets for malaria control strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.