Recombinant Anopheles quadrimaculatus ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Anopheles quadrimaculatus (Common malaria mosquito)
Target Names
ATP6
Target Protein Sequence
MMTNLFSVFDPSTTILNLSLNWLSTFLGLLLIPFSFWLLPNRFQVVWNNILLTLHKEFKT LLGPSGHNGSTLMFISLFSLIMFNNFLGLFPYIFTSTSHLTLTLALAFPLWLSFMLYGWI NHTQHMFAHLVPQGTPPVLMPFMVCIETISNVIRPGTLAVRLTANMIAGHLLLTLLGNTG PMTTNYIILSLILTTQIALLVLESAVAIIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is produced by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. As a key component of the proton channel, it may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the protein structure of Anopheles quadrimaculatus ATP6?

Anopheles quadrimaculatus ATP synthase subunit a (ATP6) is a 226 amino acid protein (based on sequence P33507) with a molecular weight of approximately 24.5 kDa. The full amino acid sequence is: MMTNLFSVFDPSTTILNLSLNWLSTFLGLLLIPFSFWLLPNRFQVVWNNILLTLHKEFKTLLGPSGHNGSTLMFISLFSLIMFNNFLGLFPYIFTSTSHLTLTLALAFPLWLSFMLYGWINHTQHMFAHLVPQGTPPVLMPFMVCIETISNVIRPGTLAVRLTANMIAGHLLLTLLGNTGPMTTNYIILSLILTTQIALLVLESAVAIIQSYVFAVLSTLYSSEVN . As a membrane protein, it contains multiple transmembrane domains that form part of the proton channel necessary for ATP synthesis.

How does ATP6 contribute to the function of ATP synthase in mosquitoes?

ATP6 forms a critical component of the proton channel in the F₀ domain of ATP synthase. During oxidative phosphorylation, it works in conjunction with a ring of 10 subunit 9 proteins (c-subunits) to facilitate proton translocation across the inner mitochondrial membrane . The proton flow through this channel drives the rotation of the c-ring, which is mechanically coupled to the F₁ catalytic domain where ATP synthesis occurs. In mosquitoes, this process is particularly important for energy production during energy-intensive activities such as flight and reproduction. ATP6 provides a direct role in proton translocation across the membrane, enabling the conversion of the proton motive force into the rotational mechanical energy that drives ATP synthesis .

How does mosquito ATP6 differ from its mammalian counterparts?

While the core function of ATP6 is conserved across species, mosquito ATP6 exhibits distinct structural features that reflect adaptations to the insect's physiology. Key differences include:

  • Sequence variations in transmembrane domains that may affect proton conductance efficiency

  • Different interactions with other subunits of the ATP synthase complex

  • Potential adaptations to function optimally at varying environmental temperatures encountered by mosquitoes

Additionally, metabolic studies in Anopheles stephensi mitochondria indicate that mosquito ATP synthase relies more heavily on the glycerol-phosphate shuttle for NADH oxidation, similar to other insect mitochondria, whereas mammalian mitochondria depend more on lactate dehydrogenase or the malate-oxaloacetate shuttle . These differences may influence how ATP6 interacts with other components of the respiratory chain.

What expression systems are most effective for producing recombinant Anopheles quadrimaculatus ATP6?

For recombinant Anopheles quadrimaculatus ATP6, E. coli has been demonstrated as an effective expression system, as evidenced by the commercial production of His-tagged full-length protein . When expressing this highly hydrophobic membrane protein, researchers should consider the following methodological approaches:

  • Use of specialized E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Expression as a fusion protein with solubility-enhancing tags (beyond just His-tags)

  • Careful optimization of induction conditions (temperature, IPTG concentration, induction time)

  • Inclusion of specific lipids or detergents in the growth medium

Purification typically involves detergent solubilization followed by affinity chromatography using the His-tag, with subsequent reconstitution into liposomes for functional studies.

What are the challenges in maintaining stability of recombinant ATP6 protein, and how can they be addressed?

Maintaining stability of recombinant ATP6 presents several challenges due to its hydrophobic nature and membrane localization. Based on information provided for commercial preparations, the following methodological solutions are recommended:

  • Store as lyophilized powder initially, which enhances long-term stability

  • Upon reconstitution, add 5-50% glycerol (final concentration) to prevent aggregation during freezing

  • Aliquot the protein to avoid repeated freeze-thaw cycles, which is explicitly not recommended

  • For working stocks, store at 4°C for up to one week rather than repeated freezing and thawing

  • Use Tris/PBS-based buffers with 6% Trehalose at pH 8.0 for optimal stability

  • When reconstituting, use a protein concentration of 0.1-1.0 mg/mL in deionized sterile water

These approaches help maintain protein integrity by preventing aggregation, protecting against denaturation during freeze-thaw cycles, and providing a stabilizing environment.

How can researchers verify the proper folding and function of recombinant ATP6?

Verifying proper folding and function of recombinant ATP6 requires multiple complementary approaches:

  • Structural verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate the accessibility of protease sites

    • Size-exclusion chromatography to determine oligomeric state

  • Functional assays:

    • Reconstitution into liposomes containing the complete ATP synthase complex

    • Measurement of proton transport using pH-sensitive fluorescent dyes

    • ATP synthesis assays when incorporated with other ATP synthase components

  • Interaction studies:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Crosslinking studies to identify proper interactions with c-ring subunits

    • Blue native PAGE to assess integration into the ATP synthase complex

Since ATP6 functions as part of the proton channel in conjunction with the c-ring, its activity can only be properly assessed in the context of a reconstituted ATP synthase complex or membrane environment.

How does ATP6 function affect mosquito metabolism and fitness?

ATP6 function directly impacts mosquito metabolism and fitness through its central role in energy production. Research suggests the following key impacts:

  • Energy balance for flight: ATP synthase efficiency directly influences flight muscle function, with ATP6 mutations potentially reducing flight capacity and dispersal ability.

  • Reproductive capacity: Energy-intensive processes like egg development require optimal ATP production; studies in other insects suggest ATP6 efficiency correlates with reproductive output.

  • Metabolic flexibility: Anopheles mosquitoes utilize diverse metabolic pathways, with ATP6 functioning as a critical component. Studies in Anopheles stephensi mitochondria reveal that, unlike mammals, these mosquitoes rely heavily on the glycerol-phosphate shuttle and can efficiently utilize proline as a substrate, contributing to metabolic adaptability .

  • Environmental adaptation: ATP synthase must function across the temperature range mosquitoes encounter. Research on pH effects on ATP synthase indicates that environmental factors can alter ATP6 function, potentially affecting mosquito survival in changing environments .

Methodologically, researchers can assess ATP6's impact on fitness through RNAi knockdown experiments, measuring parameters like flight capacity, blood meal consumption efficiency, egg production, and lifespan.

Can ATP6 variations explain metabolic differences between Anopheles species?

ATP6 variations may indeed contribute to metabolic differences between Anopheles species, though this remains an active area of research. A methodological approach to investigating this question would include:

  • Comparative sequence analysis: Alignment of ATP6 sequences across Anopheles species to identify conserved and variable regions.

  • Structure-function analysis: Modeling the impact of amino acid variations on proton channel properties.

  • Metabolic profiling: Comparing respiratory rates, ATP production efficiency, and substrate utilization across species.

  • Enzyme kinetics studies: Measuring the efficiency of ATP synthesis in isolated mitochondria from different species under standardized conditions.

Experimental evidence from Anopheles stephensi indicates distinct metabolic pathways compared to mammals, particularly in utilizing α-glycerophosphate and proline as substrates . Species-specific variations in ATP6 structure could influence the efficiency of these pathways, potentially explaining differences in habitat adaptation, host preference, and vector competence among Anopheles species.

What is the relationship between ATP6 function and insecticide resistance mechanisms?

The relationship between ATP6 function and insecticide resistance involves several interrelated metabolic pathways:

  • Energy-dependent detoxification: Increased expression of detoxification enzymes (cytochrome P450s, esterases) requires additional ATP, placing greater demands on ATP synthase efficiency.

  • Membrane potential alterations: Some insecticides target the electron transport chain. Changes in ATP6 that affect proton gradient maintenance could indirectly influence insecticide susceptibility.

  • Metabolic compensation: In resistant strains, altered ATP6 function might compensate for metabolic costs associated with resistance mechanisms.

Methodologically, researchers should approach this question through:

  • Comparative proteomics and transcriptomics of ATP6 and related genes in resistant versus susceptible strains

  • Measurement of ATP synthase activity in mitochondria isolated from resistant mosquitoes

  • Analysis of potential synergistic effects between ATP synthase inhibitors and conventional insecticides

This represents an important frontier in vector control research, as understanding the energetic basis of resistance could lead to novel strategies for overcoming it.

How do mutations in ATP6 affect proton translocation and ATP synthesis in mosquitoes?

Mutations in ATP6 can significantly disrupt proton translocation and ATP synthesis through several mechanisms. Drawing from research on pathogenic mutations in human MT-ATP6 and yeast models, we can infer the following effects in mosquitoes:

  • Proton channel disruption: Mutations in transmembrane domains may alter the proton pathway, reducing proton flow and subsequently ATP synthesis. Studies of the m.9176T>G mutation in human MT-ATP6 demonstrate how single point mutations can impair ATP synthase function .

  • Assembly defects: Some mutations affect the integration of ATP6 into the ATP synthase complex. Research in yeast shows that mutations can reduce the stability of ATP6 and its interaction with the c-ring, leading to reduced complex assembly .

  • Altered c-ring interaction: The interface between ATP6 and the c-ring is critical for proton translocation. Mutations at this interface can disrupt the rotational coupling mechanism.

Methodologically, researchers can investigate these effects through:

  • Site-directed mutagenesis of recombinant ATP6

  • Reconstitution of mutant proteins into liposomes for proton translocation assays

  • Blue native PAGE to assess complex assembly

  • Measurement of ATP synthesis rates in isolated mitochondria expressing mutant ATP6

Research in yeast models has shown that some ATP6 mutations can reduce ATP synthesis capacity to as low as 10% of wild-type levels , highlighting the potential impact of such mutations on mosquito fitness.

How does pH affect ATP6 function in Anopheles mosquitoes and what are the physiological implications?

pH significantly impacts ATP6 function through several mechanisms with important physiological implications:

  • Conformational changes: Recent research has shown that ATP synthase adopts distinct conformational states at low pH, revealing unique intermediates and plasticity in F₁-F₀ coupling . In Anopheles mosquitoes, this may be particularly relevant as they encounter varying pH environments during their life cycle, including acidic breeding waters and blood meal digestion.

  • Proton gradient alteration: Changes in environmental or cellular pH affect the proton gradient across the inner mitochondrial membrane, directly impacting ATP6's ability to facilitate proton translocation.

  • Enzyme stability: Extreme pH can affect protein stability and interactions within the ATP synthase complex.

A methodological approach to studying this includes:

  • Isolation of mitochondria from Anopheles and measurement of ATP synthesis rates across pH ranges

  • Structural studies of ATP6 under varying pH conditions using techniques like cryo-EM

  • Physiological studies correlating environmental pH with mosquito energy metabolism

Recent research by Sharma et al. (2024) identified four distinct conformational states of ATP synthase at acidic pH, including two previously undescribed states . This plasticity may represent an adaptation to maintain function during hypoxia or other stress conditions, which could be particularly relevant for mosquitoes that breed in microaerobic environments.

What is the role of ATP6 in ATP synthase assembly and how is it regulated in Anopheles mitochondria?

ATP6 plays a crucial role in ATP synthase assembly through a complex, regulated process:

  • Assembly pathway: ATP6 is incorporated late in the assembly process. Research suggests that ATP synthase assembly involves separate modules: the c-ring, F₁, and the ATP6/ATP8 complex that converge at the final stage . This likely applies to Anopheles ATP synthase as well.

  • Translational regulation: Studies indicate that ATP6 expression is translationally regulated by the F₁ sector, allowing balanced production of nuclear and mitochondrial-encoded subunits . This feedback mechanism ensures stoichiometric assembly of the complex.

  • Assembly factors: Specific chaperones (such as Atp10 and Atp23 in yeast) facilitate the assembly and stability of ATP6 and its integration with the c-ring .

  • mRNA processing: In human cells, ATP6 is expressed from two different transcripts: a tricistronic mRNA (ATP8/ATP6/CO3) and a shorter processed transcript. Interestingly, ribosome association studies suggest the tricistronic mRNA is the predominant template for translation .

Methodologically, ATP6 assembly can be studied through:

  • Pulse-chase experiments tracking newly synthesized ATP6

  • Analysis of assembly intermediates using blue native PAGE

  • Identification of assembly factors through co-immunoprecipitation studies

  • Knockdown of potential assembly factors to assess their impact

In mosquitoes, this process may have unique features reflecting adaptations to their specific physiological demands and environmental conditions.

What techniques are most effective for studying ATP6 interactions with other ATP synthase components?

Several complementary techniques can effectively elucidate ATP6 interactions with other ATP synthase components:

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify amino acids in close proximity between ATP6 and other subunits, particularly the c-ring and peripheral stalk components.

  • Blue native PAGE: This technique preserves protein-protein interactions and can resolve different assembly states of ATP synthase, allowing visualization of ATP6 incorporation into subcomplexes .

  • Co-immunoprecipitation: Using antibodies against ATP6 or other subunits to pull down interacting partners.

  • Cryo-electron microscopy: Recent advances have allowed high-resolution structures of the entire ATP synthase complex, revealing detailed interactions between subunits.

  • Genetic suppressor analysis: Identifying compensatory mutations that rescue ATP6 mutant phenotypes can reveal functional interactions. Studies in yeast have identified suppressors of pathogenic ATP6 mutations that provide insight into subunit interactions .

TechniqueAdvantagesLimitationsKey Applications
CrosslinkingCaptures transient interactionsMay introduce artifactsIdentifying precise contact points
Blue native PAGEPreserves native complexesLimited resolutionAssessing assembly intermediates
Co-IPSimple, targeted approachMay lose weak interactionsConfirming suspected interactions
Cryo-EMHigh resolution structural dataTechnically demandingDetailed structural analysis
Suppressor analysisReveals functional relationshipsLabor intensiveIdentifying compensatory mechanisms

These approaches have revealed that ATP6 interacts directly with the c-ring to form the proton channel and with subunits of the peripheral stalk that stabilize the complex .

How can researchers effectively model the impact of ATP6 variations on vector fitness and control strategies?

Effectively modeling ATP6 variations' impact on vector fitness requires a multi-level approach:

  • Molecular modeling:

    • Homology modeling of ATP6 variants based on available structures

    • Molecular dynamics simulations to predict effects on proton channel function

    • In silico prediction of protein stability and assembly competence

  • Cellular/physiological assays:

    • Generation of mosquito cell lines with ATP6 variations using CRISPR-Cas9

    • Measurement of oxygen consumption rates and ATP production

    • Assessment of mitochondrial membrane potential and proton leak

  • Whole organism studies:

    • Development of transgenic mosquitoes expressing ATP6 variants

    • Fitness measurements including developmental time, flight capacity, and reproductive output

    • Competition experiments between wild-type and variant mosquitoes

  • Population modeling:

    • Agent-based models incorporating bioenergetic costs of ATP6 variations

    • Simulation of population dynamics under various environmental conditions

    • Prediction of gene drive or insecticide efficacy in populations with ATP6 variants

This integrated approach allows researchers to connect molecular mechanisms to population-level outcomes, essential for developing effective control strategies. Considering the critical role of energy metabolism in mosquito survival and reproduction, ATP6 variations that reduce ATP synthase efficiency could significantly impact vector capacity and response to control interventions.

What are the most promising approaches for targeting ATP6 in vector control strategies?

Several promising approaches for targeting ATP6 in vector control include:

  • Small molecule inhibitors:

    • Development of specific inhibitors that bind to mosquito ATP6 but not human homologs

    • Screening of natural products known to inhibit ATP synthase for species selectivity

    • Structure-based design of inhibitors targeting mosquito-specific regions of ATP6

  • RNA interference:

    • Design of dsRNA targeting ATP6 for oral delivery to mosquitoes

    • Development of transgenic bacteria expressing ATP6-targeting dsRNA for larval consumption

    • Nanoparticle-based delivery systems for RNAi molecules

  • Gene drive approaches:

    • CRISPR-based gene drives targeting ATP6 regulatory regions

    • Introduction of recessive lethal ATP6 mutations into vector populations

    • Designed incompatibility systems based on ATP6 function

  • Immunological approaches:

    • Development of antibodies targeting exposed regions of ATP6

    • Transmission-blocking vaccines inducing antibodies that disrupt ATP6 function after blood feeding

The effectiveness of these approaches depends on ATP6's essential role in energy metabolism. Targeting ATP6 could be particularly effective because even partial reduction in ATP synthase activity can significantly impact energy-intensive processes like flight and reproduction. From studies of ATP6 mutations, we know that reductions to 10-50% of normal ATP synthesis can dramatically affect organismal fitness , suggesting that even incomplete inhibition could be effective for vector control.

How does Anopheles quadrimaculatus ATP6 compare structurally and functionally to ATP6 in other disease vectors?

Comparative analysis of ATP6 across disease vectors reveals important insights:

  • Sequence conservation: While the core functional regions of ATP6 are conserved across vectors, species-specific variations exist, particularly in transmembrane domains. Anopheles quadrimaculatus ATP6 (226 amino acids) shows high sequence similarity with other Anopheles species but diverges from Aedes and Culex vectors in specific regions.

  • Structural adaptations: These sequence differences likely reflect adaptations to:

    • Species-specific lipid environments in mitochondrial membranes

    • Thermal tolerances related to geographic distribution

    • Metabolic demands associated with feeding preferences

  • Functional implications: Comparative metabolic studies suggest that Anopheles mitochondria have distinct substrate preferences, including higher reliance on the glycerol-phosphate shuttle and proline oxidation pathways . These metabolic adaptations may correlate with ATP6 structural differences.

Methodologically, researchers should approach comparative studies through:

  • Multi-species sequence alignment and evolutionary analysis

  • Heterologous expression of ATP6 from different vectors

  • Comparative biochemical characterization of ATP synthase activity

  • Molecular modeling to identify functional consequences of sequence variations

Understanding these differences is crucial for developing species-specific vector control strategies that exploit unique features of Anopheles quadrimaculatus ATP6.

What future research directions will advance our understanding of ATP6 in vector biology?

Critical future research directions include:

  • High-resolution structural studies:

    • Cryo-EM structures of Anopheles ATP synthase with focus on ATP6 conformation

    • Comparative structural analysis across vector species

    • Mapping of lipid-protein interactions specific to mosquito ATP6

  • Systems biology approaches:

    • Integration of ATP6 function with comprehensive metabolic models of energy metabolism

    • Multi-omics studies correlating ATP6 variants with metabolic phenotypes

    • Network analysis of ATP6 interactions with other mitochondrial systems

  • Environmental adaptation mechanisms:

    • Investigation of how ATP6 function adapts to temperature and pH fluctuations

    • Analysis of ATP6 polymorphisms across geographic populations

    • Study of epigenetic regulation of ATP6 expression in response to environmental stressors

  • Applied research:

    • Development of high-throughput screening systems for ATP6-targeting compounds

    • Design of genetically modified vectors with altered ATP6 function for population replacement strategies

    • Evaluation of ATP6 as a marker for insecticide resistance monitoring

These research directions will not only advance our fundamental understanding of vector biology but also potentially lead to novel control strategies based on disrupting energy metabolism in disease vectors.

How might climate change affect ATP6 function in mosquito vectors, and what are the implications for disease transmission?

Climate change could significantly impact ATP6 function in mosquitoes through several mechanisms:

  • Temperature effects on enzyme kinetics:

    • Rising temperatures alter the kinetics of ATP synthase, potentially affecting efficiency

    • Research on yeast ATP synthase indicates that temperature affects the conformational states of the enzyme, which would impact ATP6 function

    • These changes may shift the balance between ATP synthesis and proton leak

  • Adaptive evolution:

    • Thermal stress may drive selection for ATP6 variants with different thermal optima

    • Such adaptations could influence vector competence and geographic distribution

    • Molecular evolution studies could track these changes in real-time

  • Metabolic compensation:

    • Changes in ATP6 efficiency may necessitate compensatory metabolic adaptations

    • Altered energy budgets could affect feeding frequency, potentially increasing disease transmission

    • Studies in Anopheles stephensi show metabolic flexibility that may become increasingly important

  • pH interactions:

    • Climate-driven changes in breeding water chemistry (pH, dissolved oxygen) may interact with ATP6 function

    • Recent research shows ATP synthase adopts distinct conformations at low pH , which may become more relevant as aquatic habitats change

Methodological approaches to studying these effects include:

  • Laboratory evolution experiments under projected climate conditions

  • Metabolic measurements across temperature gradients

  • Field sampling to track ATP6 polymorphisms along climate gradients

  • Modeling energy budgets under various climate scenarios

Understanding these interactions will be crucial for predicting shifts in vector-borne disease patterns and developing adaptive control strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.