Recombinant Anoxybacillus flavithermus Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag type, please inform us during your order; we will prioritize its development.
Synonyms
cbiM; Aflv_2184; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-250
Protein Length
Full Length of Mature Protein
Species
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Target Names
cbiM
Target Protein Sequence
MHIMEGFLPWQWALVWWLLFLPFFLVGMRNVARLMRQRPEVKLLLALATAFTFVLSALKI PSVTGSSSHPTGTGLGALLFGPFVMTVIGTAVLLFQALLLAHGGVTTLGANAFSMAVVGP LVAYVLFSLCKKFGVSTRVSVFLAAMMADLATYVMTSIQLALAFPDATSGVWGAFLKFAS IFAVTQIPLAITEGLLTVVVWNFLHTYSKRELTILQQKGATIE
Uniprot No.

Target Background

Function
Component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt ion import.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Anoxybacillus flavithermus and where is it naturally found?

Anoxybacillus flavithermus is a gram-positive, endospore-forming, facultative anaerobic microorganism that exhibits intense yellow pigmentation. It was first discovered in a New Zealand hot spring and was initially classified as Bacillus flavithermus before being reclassified under the genus Anoxybacillus, which was proposed in 2000. A. flavithermus has been isolated from various geothermally heated environments, including volcanic sites such as Deception Island in Antarctica, where the temperature can reach up to 100°C near fumaroles. The bacterium is particularly noted for its ability to grow in a thermotolerant range of 37-70°C and in super-saturated silica solutions and opaline silica sinter .

What is the cobalt transport protein CbiM and what is its role in A. flavithermus?

The cobalt transport protein CbiM is a component of the cobalt transport system typically encoded in the cbiMNQO operon in bacteria. While the search results don't specifically describe CbiM in A. flavithermus, we can infer from comparative genomics that it likely functions similarly to CbiM in other bacteria. The protein is involved in the active transport of cobalt ions into the bacterial cell, which is essential for vitamin B12 (cobalamin) biosynthesis since cobalt serves as the central metal ion in the vitamin B12 molecule . In thermophilic bacteria like A. flavithermus, these transport systems may have unique adaptations for function at high temperatures.

How does the genome of A. flavithermus inform our understanding of CbiM function?

The genome of A. flavithermus strains is approximately 3.0 Mb in size with a G+C content of about 42% and encodes approximately 3,500 proteins. Genomic analysis of A. flavithermus strains has revealed genes related to genome stabilization, DNA repair systems, temperature adaptation, and resistance to alkaline conditions . While the specific characteristics of the cbiM gene in A. flavithermus aren't directly addressed in the search results, genomic studies would typically involve identifying the cbiM gene sequence, examining its organization within potential operons, analyzing its promoter regions, and comparing its sequence with homologs from other bacteria to predict functional characteristics.

What expression systems are most effective for producing recombinant A. flavithermus CbiM protein?

Based on comparable research with other bacterial membrane proteins, E. coli expression systems are commonly used for recombinant production of bacterial transport proteins. For thermophilic proteins like those from A. flavithermus, expression systems might require optimization to handle potential protein folding issues. Based on the metabolic engineering approaches described for related proteins, a strategy might involve using E. coli strains like BL21(DE3) or MG1655(DE3) with expression vectors such as pACYCDuet-1 or pCDFDuet-1 . The expression should be optimized by testing various induction conditions (IPTG concentration, temperature, and duration) to obtain the correctly folded functional protein.

What purification strategies yield the highest purity and activity for recombinant CbiM proteins?

Purification of membrane transport proteins like CbiM typically requires a multi-step approach. Based on the methodologies described for similar proteins, an effective strategy would include: 1) Cell lysis using methods gentle enough to maintain protein structure, such as sonication or pressure-based disruption; 2) Membrane fraction isolation through differential centrifugation; 3) Solubilization of the membrane protein using appropriate detergents; 4) Affinity chromatography, often utilizing a hexa-histidine tag as described for other recombinant proteins in the search results ; 5) Size exclusion chromatography for further purification; and 6) Analysis of protein purity using SDS-PAGE and Western blotting. The purification conditions should be optimized to maintain the thermostability characteristics of the A. flavithermus protein.

How can researchers verify the functional integrity of recombinant A. flavithermus CbiM after purification?

The functional verification of recombinant CbiM would involve assessing its cobalt transport activity. This can be done through: 1) Cobalt uptake assays using radioisotope-labeled cobalt (⁶⁰Co) to measure transport across reconstituted proteoliposomes; 2) Binding assays to determine the affinity of CbiM for cobalt ions; 3) Complementation studies in cbiM-deficient bacterial strains to assess functional rescue; 4) Structural integrity verification using circular dichroism spectroscopy to confirm proper protein folding, especially important for thermophilic proteins; and 5) Thermal stability assays to ensure the recombinant protein retains the thermostability characteristic of proteins from A. flavithermus, which grows in temperatures ranging from 37-70°C .

How does the structure of A. flavithermus CbiM compare to homologous proteins from mesophilic bacteria?

The structural comparison would require determining the three-dimensional structure of A. flavithermus CbiM using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy, followed by comparative analysis with structures of homologous proteins from mesophilic bacteria. Key structural features to analyze would include: 1) Thermal adaptation signatures such as increased hydrophobic interactions, additional salt bridges, and reduced loop regions; 2) Transmembrane domain organization that might reveal differences in membrane interaction at varied temperatures; 3) Metal binding sites that could show adaptations for cobalt coordination at high temperatures; and 4) Structural flexibility differences that might explain functional adaptation to thermophilic conditions. These analyses could provide insights into the molecular basis of protein thermostability in A. flavithermus.

What are the specific amino acid residues in A. flavithermus CbiM responsible for cobalt ion specificity and transport?

Identifying the amino acid residues responsible for cobalt specificity and transport would involve: 1) Sequence alignment with well-characterized cobalt transporters from other bacteria; 2) Site-directed mutagenesis of conserved residues predicted to be involved in cobalt binding or transport; 3) Functional assays of the mutant proteins to assess changes in transport efficiency or ion selectivity; 4) Structural studies focusing on the metal-binding sites, potentially using cobalt or cobalt-mimicking ions for co-crystallization; and 5) Computational modeling and molecular dynamics simulations to predict the cobalt transport pathway through the protein. This research would provide fundamental insights into the mechanism of selective metal ion transport across bacterial membranes.

How does the thermostability of A. flavithermus CbiM relate to its functional characteristics?

Investigation of the relationship between thermostability and function would involve: 1) Comparative activity assays at different temperatures (from mesophilic to thermophilic ranges); 2) Analysis of protein unfolding using differential scanning calorimetry or thermal shift assays; 3) Correlation of thermal stability data with transport efficiency measurements; 4) Engineering of chimeric proteins between A. flavithermus CbiM and mesophilic homologs to identify regions crucial for thermostability; and 5) Structural analysis focused on identifying features that contribute to thermostability without compromising function. This research would address how A. flavithermus CbiM maintains functional integrity at high temperatures, which is relevant given the bacterium's ability to thrive in environments with temperatures up to 70°C .

What can comparative analysis of the cbiMNQO operon across different A. flavithermus strains reveal about environmental adaptation?

Comparative analysis of the cbiMNQO operon across different A. flavithermus strains, particularly those isolated from diverse geothermal environments like those on Deception Island, would involve: 1) Whole genome sequencing and annotation of multiple strains from different thermal environments; 2) Detailed comparison of the cbiMNQO operon sequences, including coding regions and regulatory elements; 3) Correlation of sequence variations with specific environmental parameters (temperature, pH, metal ion availability); 4) Expression analysis under varied conditions to identify differential regulation; and 5) Functional characterization of variant proteins to assess adaptation to specific conditions. This research would provide valuable insights into how environmental pressures shape the evolution of essential transport systems in extremophiles .

How can the thermostable properties of A. flavithermus CbiM be exploited for biotechnological applications?

The exploration of biotechnological applications would involve: 1) Assessment of CbiM stability and activity in various industrial conditions (high temperatures, extreme pH, presence of detergents or organic solvents); 2) Engineering of CbiM as a component in synthetic biology systems requiring thermostable metal transport, such as whole-cell biocatalysts for high-temperature bioprocesses; 3) Development of biosensors for cobalt detection in environmental samples using the metal-binding properties of CbiM; 4) Investigation of CbiM as a potential model for designing thermostable membrane proteins for industrial applications; and 5) Exploration of applications in bioremediation of cobalt-contaminated environments, particularly those at elevated temperatures. This research would contribute to the growing interest in A. flavithermus for various industrial applications including biofuel production, pharmacology, and bioengineering .

What role might A. flavithermus CbiM play in optimizing vitamin B12 production systems?

Investigation of CbiM's role in vitamin B12 production would involve: 1) Analysis of cobalt uptake efficiency in relation to cobalamin synthesis rates; 2) Engineering of expression systems co-expressing A. flavithermus CbiM with cobalamin biosynthetic pathways in production hosts; 3) Optimization of cobalt availability and transport for maximum vitamin B12 yield; 4) Comparative studies with cobalt transport systems from other organisms to identify the most efficient system for vitamin B12 production; and 5) Integration of the thermostable CbiM into high-temperature fermentation processes for vitamin B12 production. This research would build upon existing metabolic engineering approaches for vitamin B12 biosynthesis, potentially improving production efficiency through enhanced cobalt transport capabilities .

What are the most effective protocols for analyzing the interaction between A. flavithermus CbiM and other components of the cobalt transport system?

Analysis of protein-protein interactions would involve: 1) Co-immunoprecipitation studies using antibodies against CbiM to pull down interacting partners; 2) Bacterial two-hybrid or split-ubiquitin assays optimized for membrane protein interactions; 3) Cross-linking studies followed by mass spectrometry to identify interaction interfaces; 4) Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays using fluorescently labeled proteins to study interactions in real-time; and 5) Co-expression and co-purification approaches for the entire CbiMNQO complex, using strategies similar to those described for other protein complexes in the search results . The methodologies would need to be optimized for thermophilic proteins, potentially including stability assessments at various temperatures to ensure meaningful results.

How can researchers effectively study the regulation of cbiM gene expression in A. flavithermus under various environmental conditions?

Studying gene regulation would involve: 1) Reporter gene assays using the cbiM promoter region fused to reporter genes such as green fluorescent protein or luciferase; 2) Quantitative RT-PCR to measure cbiM transcript levels under various conditions (cobalt availability, temperature, pH); 3) Chromatin immunoprecipitation to identify transcription factors that bind to the cbiM promoter; 4) In vitro transcription assays to study the direct effects of environmental factors on promoter activity; and 5) Global transcriptome analysis using RNA-seq to understand cbiM regulation in the context of the entire cellular response to environmental changes. These approaches would provide insights into how A. flavithermus regulates cobalt uptake in response to environmental stimuli, particularly in its natural geothermal habitat .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.