Recombinant Anoxybacillus flavithermus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Taxonomic Classification and Discovery

Anoxybacillus flavithermus is a thermophilic bacterium belonging to the family Bacillaceae and phylum Firmicutes. The genus Anoxybacillus is relatively new, having been proposed in 2000. A. flavithermus was initially described as Bacillus flavithermus, discovered in a New Zealand hot spring, and later reclassified based on phylogenetic analyses .

Environmental Distribution and Adaptation

A. flavithermus has been isolated from diverse geothermal environments worldwide, including Antarctica's Deception Island, a marine stratovolcano with remarkable temperature gradients. Near fumaroles, temperatures can reach up to 100°C, while subzero temperatures exist in nearby glaciers. The bacterium exhibits remarkable adaptability to these extreme conditions .

Physiological Characteristics

A. flavithermus is characterized as a gram-positive, endospore-forming, facultatively anaerobic microorganism with distinctive yellow pigmentation. It demonstrates thermotolerant growth capabilities, thriving at temperatures between 30-70°C, as documented in strains isolated from Antarctic geothermal sites .

General Genome Structure

The genome of A. flavithermus is approximately 3.0 Mb in size with a G+C content of 42%. Genomic analysis predicts approximately 3,500 protein-coding genes. Comparative genomic studies reveal that A. flavithermus strains isolated from similar environments share high genomic similarity, with Average Nucleotide Identity (ANI) values exceeding 98% among strains from the same location .

Evolutionary Relationships

Phylogenomic analyses place A. flavithermus strains in close relation to each other (ANI >98%) and to other A. flavithermus reference strains (ANI 95%). This suggests a common evolutionary history among thermophilic bacilli adapted to similar environmental niches .

Adaptive Genetic Elements

Genomic analysis has identified 15 resistance and metabolic islands in A. flavithermus. These contain genes related to genome stabilization, DNA repair systems for protection against UV radiation, temperature adaptation mechanisms, heat and cold shock proteins (Csps), and alkaline condition resistance. These genomic elements contribute to the bacterium's remarkable adaptability to extreme environments .

Protein Classification and Homology

MscL belongs to a conserved family of mechanosensitive channels found across bacterial species. Comparing the A. flavithermus mscL with homologs from other species, such as Bacillus subtilis, reveals important structural and functional conservation despite adaptation to different environmental niches .

Physiological Role

The large-conductance mechanosensitive channel plays a crucial role in bacterial osmoregulation. It responds to mechanical tension in the cell membrane, particularly during osmotic downshock, preventing cell lysis by releasing cytoplasmic solutes .

Importance in Extremophile Adaptation

In extremophiles like A. flavithermus, which experience significant temperature and pressure fluctuations in their natural habitats, mechanosensitive channels are particularly important for maintaining cellular integrity and function under rapidly changing environmental conditions .

Expression Systems

Recombinant A. flavithermus mscL is typically expressed in heterologous systems, with Escherichia coli being the predominant expression host. The protein is commonly produced with an N-terminal His-tag to facilitate purification .

Protein Properties and Handling

Table 1. Key Properties of Recombinant A. flavithermus mscL Protein

PropertyDescription
Protein LengthFull Length (1-131 amino acids)
Expression SystemE. coli
TagHis-tag (typically N-terminal)
Physical FormLyophilized powder
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL; addition of 5-50% glycerol recommended for long-term storage

The recombinant protein requires careful handling, with recommendations to avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

Research Applications

The protein is primarily used for:

  • Structural studies of mechanosensitive channels

  • Investigation of membrane protein folding and function

  • Research on extremophile adaptations

  • Development of biosensors and other biotechnological applications leveraging its thermostable properties

Comparison with MscL from Other Species

Table 2. Comparison of MscL Proteins from Different Bacterial Species

SpeciesProtein LengthNotable FeaturesUniProt ID
Anoxybacillus flavithermus131 aaThermostable, functions in wide temperature rangeB7GLN3
Bacillus subtilisVariableMesophilic adaptationP94585
Psychrobacter sp.143 aaCold-adapted mechanosensitive channelA5WCE5

The comparison reveals adaptations in the protein structure that correlate with the environmental niches of the respective bacteria. A. flavithermus mscL shows adaptations for thermostability, while those from psychrophilic bacteria exhibit modifications for cold function .

Enzyme Applications

Although not an enzyme itself, A. flavithermus as a source organism has significant biotechnological potential. Genomic analysis has revealed numerous genes encoding thermostable enzymes with industrial applications, including glycosyl hydrolases. The extremophilic nature of the organism makes its proteins, including mscL, potential candidates for applications requiring thermostability .

Future Research Directions

Future research on recombinant A. flavithermus mscL may focus on:

  • Structural studies to better understand its gating mechanism in response to mechanical force

  • Engineering the protein for biosensor applications

  • Investigation of its potential as a component in synthetic biological systems

  • Exploration of its role in A. flavithermus' adaptation to extreme environments

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; Aflv_2070; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Target Names
mscL
Target Protein Sequence
MWQEFKKFAVRGNVIDLAVGVIIGGAFGKIVSSLVNDIIMPLVGLILGGIDFSGLSWKVG EAEVKYGAFLQTVVDFLVIAFSIFLFVKLLNNLHERIKKQEETKQTAPTMTKEQQLLTEI RDLLKQQKETP
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the key genomic features of Anoxybacillus flavithermus relevant to MscL research?

Anoxybacillus flavithermus possesses a genome approximately 3.0 Mb in size with a G+C content of 42%, encoding approximately 3500 proteins. The genome contains multiple genes associated with adaptation to extreme environments, including those encoding mechanosensitive channels that help maintain cellular integrity during osmotic stress . When designing expression systems for recombinant MscL production, researchers should consider that A. flavithermus is phylogenetically distinct from common laboratory strains, necessitating codon optimization and thermostable expression vectors. Analyzing the genomic context of the MscL gene is critical, as neighboring genes may influence expression and function.

How does the thermophilic nature of Anoxybacillus flavithermus affect MscL structure and function?

A. flavithermus thrives at temperatures between 37-70°C, classifying it as a thermophilic organism . This thermophilic adaptation manifests in the MscL protein through:

Structural FeatureImpact on MscL FunctionResearch Implication
Increased hydrophobic interactionsEnhanced stability at high temperaturesRequires modified purification protocols
Higher proportion of charged residuesMaintains protein folding at elevated temperaturesAffects solubility in standard buffers
Modified membrane lipid interactionsAltered gating mechanics compared to mesophilic MscLNecessitates temperature-controlled functional assays

Researchers should conduct comparative analyses with mesophilic MscL homologs (such as from E. coli) to identify thermophilic adaptations. Functional assays should be performed at both standard laboratory temperatures (20-25°C) and the organism's growth optimum (55-60°C) to accurately characterize activity.

What expression systems are most effective for producing recombinant A. flavithermus MscL?

When expressing recombinant A. flavithermus MscL, researchers should consider the following methodological approaches:

  • Host selection: While E. coli is the most common heterologous expression host, thermophilic expression hosts like Geobacillus species may provide better folding environments for A. flavithermus proteins.

  • Vector design: Incorporate strong inducible promoters (e.g., T7 or tac) with thermostable selection markers. Include a fusion tag (His6, GST, or MBP) to facilitate purification, but position it carefully to avoid interference with channel assembly.

  • Induction protocol: Optimize induction temperature, typically 30°C for E. coli hosts expressing thermophilic proteins to balance expression level with proper folding.

  • Membrane fraction isolation: Implement differential centrifugation followed by detergent solubilization (typically using n-dodecyl-β-D-maltoside or LDAO) to extract MscL from membranes without denaturation .

Researchers frequently encounter low yields due to toxicity from membrane protein overexpression. To address this, consider using C41(DE3) or C43(DE3) E. coli strains specifically developed for membrane protein expression.

How can one design experiments to accurately measure the gating threshold of A. flavithermus MscL compared to mesophilic homologs?

Designing experiments to determine gating thresholds requires sophisticated methodological approaches:

  • Patch-clamp electrophysiology: The gold standard for measuring MscL gating directly. For comparison studies between A. flavithermus MscL and mesophilic homologs, implement the following protocol:

    • Reconstitute purified channels in azolectin liposomes with consistent protein-to-lipid ratios

    • Form giant unilamellar vesicles (GUVs) for patch-clamp access

    • Apply negative pressure incrementally while recording in inside-out configuration

    • Analyze pressure-current relationships at multiple temperatures (25°C, 37°C, 55°C)

  • Fluorescence-based assays: Implement FRET-based reporters by labeling cysteine residues introduced at strategic locations. This permits:

    • Real-time monitoring of conformational changes during gating

    • High-throughput screening across various conditions

    • Assessment of temperature-dependent dynamics

  • Statistical analysis framework: Apply a one-way ANOVA to determine significant differences between gating parameters:

    SourceSSdfMSF
    Temperature[Calculated]2[Calculated][Calculated]
    Channel type[Calculated]1[Calculated][Calculated]
    Interaction[Calculated]2[Calculated][Calculated]
    Error[Calculated][n-5][Calculated]
    Total[Calculated][n-1]

Significant differences should be analyzed using Tukey's post-hoc test with α = 0.05 .

A critical confounding variable is membrane composition, which substantially influences gating tension. To address this, researchers should perform control experiments with consistent lipid compositions across all channel variants.

What unique adaptations in A. flavithermus MscL might explain its function in extremophilic environments?

Analysis of A. flavithermus adaptations requires integration of structural, functional, and computational approaches:

  • Comparative sequence analysis: Align MscL sequences from organisms across temperature gradients (psychrophilic, mesophilic, thermophilic). Focus on:

    • Transmembrane domain conservation

    • C-terminal cytoplasmic domain variations

    • N-terminal amphipathic helix modifications

  • Molecular dynamics simulations: Perform temperature-dependent simulations (300-340K) of membrane-embedded MscL models to identify:

    • Differential lipid-protein interactions

    • Temperature-sensitive conformational changes

    • Water permeation pathways

  • Site-directed mutagenesis: Create chimeric channels combining domains from thermophilic and mesophilic MscL to isolate temperature-adaptive regions. Key residues identified through computational approaches should be systematically mutated to analyze their contribution to thermostability.

Research has revealed that thermophilic MscL channels typically exhibit:

  • Higher proportion of charged residues in loop regions

  • Modified hydrophobic patterning in transmembrane helices

  • Increased salt bridge networks in cytoplasmic domains

These adaptations must be studied in the context of A. flavithermus' natural environment, considering that Antarctic volcanic sites present unique selective pressures combining high temperatures with otherwise cold surroundings .

How does the interaction between A. flavithermus MscL and membrane lipids differ from mesophilic MscL-lipid interactions?

The lipid-protein interactions of mechanosensitive channels are fundamentally important to their function, as membrane tension directly triggers channel gating . For A. flavithermus MscL, these interactions present unique research challenges:

  • Lipidomic analysis: Compare native A. flavithermus membranes with mesophilic bacterial membranes to identify lipid composition differences:

    • Higher proportion of saturated fatty acids in thermophiles

    • Presence of specialized membrane-stabilizing lipids

    • Modified headgroup distribution

  • Functional reconstitution assay:

    • Purify recombinant MscL from both A. flavithermus and E. coli

    • Reconstitute in liposomes with systematically varied lipid compositions

    • Measure gating thresholds using patch-clamp electrophysiology

    • Analyze pressure-sensitivity curves using the function:
      P(open) = 1/(1+exp(α(P-P₁/₂)))
      where P₁/₂ is the pressure at which channels are open 50% of the time

  • Molecular mechanism investigation:

    • Perform tryptophan fluorescence scanning at the protein-lipid interface

    • Measure lipid-dependent changes in fluorescence emission wavelength

    • Calculate binding affinities for different lipid species

Expected results typically show that thermophilic MscL proteins require thicker, more rigid membrane environments to maintain appropriate tension sensitivity at higher temperatures. This can be quantified through tension threshold measurements across lipid compositions with varying thicknesses and fluidities.

What experimental approaches can resolve contradictory data regarding A. flavithermus MscL conductance properties?

When confronted with conflicting results in MscL conductance measurements, implement the following methodological framework:

  • Standardize experimental conditions:

    • Establish uniform expression and purification protocols

    • Create a reference liposome composition for reconstitution

    • Develop standardized electrophysiology parameters

  • Multi-technique validation:

    • Complement patch-clamp studies with fluorescence-based flux assays

    • Implement stopped-flow measurements of ion/solute flux

    • Utilize planar lipid bilayer recordings for single-channel conductance

  • Statistical approach to contradictory data:

    • Apply a factorial design experiment to systematically test variables:

    FactorLevelsDescription
    Temperature25°C, 37°C, 55°CPhysiological relevance
    Membrane tension5-25 mN/mApplied in 5 mN/m increments
    Ionic strength100, 200, 300 mM KClEvaluate charge effects
    pH6.0, 7.0, 8.0Assess protonation influences
    • Conduct blocked ANOVA with laboratory/research group as a random effect

    • Calculate effect sizes and confidence intervals for all parameters

  • Molecular basis investigation:

    • Implement single-molecule techniques (FRET, AFM) to directly observe conformational states

    • Create site-directed mutants at putative conductance-determining residues

    • Perform computational electrostatics calculations to model ion pathway properties

When analyzing contradictory literature, researchers should pay particular attention to differences in experimental temperature, as A. flavithermus proteins may exhibit significantly different properties at standard laboratory temperatures versus their physiological optimum.

How should researchers design controls when studying the influence of temperature on A. flavithermus MscL function?

Appropriate control design is critical for temperature-dependent studies of A. flavithermus MscL:

  • Protein stability controls:

    • Circular dichroism measurements at each experimental temperature

    • Differential scanning calorimetry to establish thermal denaturation profile

    • Size-exclusion chromatography to confirm oligomeric state preservation

  • Membrane integrity controls:

    • Calcein leakage assays to verify liposome stability across temperature range

    • Laurdan fluorescence to measure membrane fluidity changes

    • Fluorescence anisotropy measurements with DPH probes

  • Comparative controls:

    • Include parallel experiments with E. coli MscL (mesophilic)

    • Test thermally stable but mechanically insensitive membrane proteins

    • Examine non-functional MscL mutants with known gating defects

  • Technical controls:

    • Temperature calibration directly at the measurement chamber

    • Equilibration time standardization

    • Buffer pH adjustment for temperature-dependent shifts

Implementation of a Latin square experimental design can efficiently control for order effects when testing multiple temperatures, ensuring that any observed differences are attributable to temperature rather than experimental sequence or sample degradation .

What are the methodological challenges in purifying functional recombinant A. flavithermus MscL and how can they be overcome?

Purifying functional thermophilic membrane proteins presents several methodological challenges:

  • Expression optimization:

    • Challenge: Protein misfolding in mesophilic expression hosts

    • Solution: Implement cold-shock induction protocols (18-20°C) with extended expression times (24-48 hours)

    • Validation: Monitor protein distribution between membrane and inclusion body fractions

  • Solubilization efficiency:

    • Challenge: Incomplete extraction from membranes

    • Solution: Screen detergent panel including DDM, LDAO, DMNG, and SMA copolymers

    • Optimization: Implement two-step solubilization with initial short exposure to stronger detergents followed by exchange to milder ones

  • Thermostability during purification:

    • Challenge: Maintaining native conformation throughout purification

    • Solution: Include specific lipids (POPE, POPG) throughout purification

    • Implementation: Add lipids directly to detergent micelles at 0.1-0.2 mg/mL

  • Functional verification:

    • Challenge: Confirming channel functionality post-purification

    • Solution: Develop a fluorescence-based liposome flux assay compatible with high-throughput screening

    • Analysis: Calculate protein activity recovery at each purification step

Purification StepProtein Recovery (%)Specific Activity (%)Purification Factor
Membrane fraction1001001.0
Detergent solubilization75-8570-800.9
Affinity chromatography40-5060-701.3
Size exclusion25-3550-601.8
Reconstitution20-3040-502.0

A critical methodological advance is the implementation of amphipathic polymers (SMALPs) which extract membrane proteins with their native lipid environment intact, potentially preserving thermophilic adaptations that might otherwise be lost during conventional detergent purification.

How can researchers accurately interpret gating kinetics data for A. flavithermus MscL across different temperatures?

Interpreting temperature-dependent gating kinetics requires sophisticated analysis approaches:

  • Temperature-corrected Boltzmann distribution analysis:

    • Fit single-channel open probability data to the equation:
      P(open) = 1/(1+exp(ΔG/kT))

    • Extract ΔG values at each temperature

    • Plot ΔG vs. 1/T (van't Hoff plot) to determine enthalpic and entropic contributions

  • Transition state theory application:

    • Calculate opening and closing rates (kₒ and kₖ) from dwell time analysis

    • Apply Eyring equation to determine activation energies:
      ln(k/T) = -ΔH‡/RT + ΔS‡/R + ln(kв/h)

    • Compare activation energies between A. flavithermus MscL and mesophilic homologs

  • Data interpretation challenges:

    • Account for temperature-dependent changes in membrane properties

    • Distinguish intrinsic channel temperature responses from membrane effects

    • Consider temperature-dependent changes in buffer properties affecting ion conductance

  • Statistical robustness:

    • Implement repeated measures ANOVA for temperature series data

    • Calculate Q₁₀ values to quantify temperature dependence

    • Apply non-parametric alternatives (Friedman test) when data violate normality assumptions

A principal interpretation challenge arises from the non-linear relationship between temperature, membrane fluidity, and channel function. Researchers should construct Arrhenius plots for various parameters (opening rate, conductance, tension threshold) to identify transition points that may indicate changes in the rate-limiting step of channel activation.

What bioinformatic approaches can predict functional differences between A. flavithermus MscL and other bacterial MscL homologs?

Leveraging computational approaches can provide valuable insights before experimental implementation:

  • Comparative sequence analysis:

    • Multiple sequence alignment of MscL homologs from diverse bacteria

    • Calculate conservation scores for each position

    • Generate sequence logos to visualize conservation patterns

    • Identify thermophile-specific substitution patterns

  • Structural bioinformatics:

    • Homology modeling using crystal structures as templates

    • Molecular dynamics simulations at various temperatures

    • Principal component analysis of conformational flexibility

    • Essential dynamics analysis to identify functionally relevant motions

  • Evolutionary analysis:

    • Construct phylogenetic trees of MscL sequences

    • Calculate dN/dS ratios to identify positions under positive selection

    • Perform ancestral sequence reconstruction to trace evolutionary trajectories

    • Identify co-evolving residue networks using mutual information analysis

  • Machine learning implementation:

    • Train models to predict temperature adaptations based on sequence features

    • Implement feature importance analysis to identify critical residues

    • Use transfer learning approaches when working with limited thermophilic MscL data

Key residues predicted to be functionally important should be experimentally validated through site-directed mutagenesis and functional assays. Particular attention should be paid to residues at the protein-lipid interface, as these often contribute to thermophilic adaptation through modified hydrophobic interactions.

How might understanding A. flavithermus MscL contribute to developing new antibiotic delivery systems?

Mechanosensitive channels have potential applications in antibiotic delivery based on their natural properties :

  • Theoretical framework:

    • MscL channels function as tension-activated nanovalves

    • They permit passage of molecules up to ~30 Å diameter when fully open

    • Thermostable MscL variants offer platform stability advantages

    • A. flavithermus MscL may provide unique thermal gating properties

  • Methodological approach:

    • Engineer modified A. flavithermus MscL with altered gating thresholds

    • Develop reconstituted liposome systems with incorporated MscL channels

    • Design triggering mechanisms (osmotic, thermal, or chemical)

    • Test delivery of model compounds before antibiotic loading

  • Experimental design:

    • Create chimeric channels combining thermostability of A. flavithermus MscL with engineered gating properties

    • Implement high-throughput screening to identify compounds that modulate channel activity

    • Develop proteoliposomes with tailored lipid compositions to optimize channel function

  • Potential antibiotic applications:

    • Enhanced delivery of large molecular weight antibiotics

    • Targeted release in response to membrane perturbations characteristic of infection sites

    • Thermally triggered release systems utilizing the thermostable properties of A. flavithermus MscL

Research shows that certain antibiotics, including viomycin and nifuroxazide, already utilize mechanosensitive channels as entry pathways . Understanding A. flavithermus MscL could lead to optimized delivery systems with greater thermal stability and defined activation parameters.

What are the most promising approaches for studying structure-function relationships in A. flavithermus MscL?

Advanced structural biology techniques offer powerful approaches for understanding A. flavithermus MscL:

  • Cryo-electron microscopy:

    • Advantages: Can capture multiple conformational states, works well with membrane proteins

    • Implementation: Purify protein in amphipols or nanodiscs to maintain native-like environment

    • Analysis: Perform 3D classification to identify distinct conformational states

    • Resolution target: Aim for <3.5Å resolution to resolve side chain positions

  • X-ray crystallography with LCP (Lipidic Cubic Phase):

    • Suitable for membrane proteins in lipid environments

    • Requires thermostability screening to identify constructs amenable to crystallization

    • Implement surface entropy reduction mutations to promote crystal contacts

    • Consider fusion partners (e.g., BRIL, T4 lysozyme) to aid crystallization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps protein dynamics and solvent accessibility

    • Can probe conformational changes under mechanical stress

    • Particularly valuable for comparing dynamics at different temperatures

    • Implementation: Compare exchange rates between resting and activated states

  • Site-directed spin labeling with EPR spectroscopy:

    • Provides information about distances between labeled residues

    • Enables measurement of conformational changes during gating

    • Temperature-dependent measurements provide insights into thermophilic adaptations

    • Double electron-electron resonance (DEER) measurements can provide distance constraints

Structure-function relationships should be studied across temperature ranges relevant to A. flavithermus biology (37-70°C), with particular attention to identifying thermal adaptations that maintain mechanosensitivity at elevated temperatures .

What are the critical knowledge gaps that remain in our understanding of A. flavithermus MscL?

Despite considerable progress in mechanosensitive channel research, several critical knowledge gaps remain specific to A. flavithermus MscL:

  • Complete gating mechanism under thermophilic conditions:

    • How temperature affects the energy landscape of channel gating

    • Whether intermediate conformational states differ from mesophilic homologs

    • The relationship between temperature and tension sensitivity

  • Native lipid environment characterization:

    • Complete lipidomic profile of A. flavithermus membranes

    • Specific lipid-protein interactions that enable thermophilic function

    • Temperature-dependent changes in membrane-protein coupling

  • Physiological role in extremophilic adaptation:

    • Contribution to survival in thermal fluctuation environments

    • Integration with other stress response systems

    • Potential unique functions beyond osmotic protection

Future research should apply integrative approaches combining structural biology, electrophysiology, molecular dynamics simulations, and in vivo studies to address these knowledge gaps. Comparative studies between A. flavithermus MscL and homologs from other thermophiles could reveal convergent or divergent evolutionary strategies for maintaining mechanosensitivity at high temperatures .

How should researchers approach contradictory findings in the literature regarding A. flavithermus MscL properties?

When confronting contradictory findings in the literature, researchers should implement a systematic approach:

  • Metadata analysis:

    • Create a comprehensive table of experimental conditions across studies

    • Identify methodological differences (protein constructs, expression systems, buffers)

    • Analyze statistical approaches and sample sizes

    • Consider laboratory-specific effects and potential systematic biases

  • Reproducibility assessment:

    • Implement blinded reproduction of key experiments

    • Standardize protocols across research groups

    • Consider round-robin testing among multiple laboratories

    • Apply statistical meta-analysis techniques to existing datasets

  • Reconciliation strategies:

    • Test hypotheses that could explain apparent contradictions

    • Identify parameter spaces where different models converge

    • Develop computational models that can accommodate seemingly contradictory data

    • Consider whether protein heterogeneity could explain divergent results

  • Forward-looking experimental design:

    • Implement factorial designs that systematically vary key parameters

    • Increase statistical power through larger sample sizes

    • Pre-register experimental protocols to reduce bias

    • Share raw data and analysis code to enable independent verification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.