Recombinant Anoxybacillus flavithermus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Aflv_1810; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Target Names
lspA
Target Protein Sequence
MLWRGVMLYYLLAFVVILIDQWTKWLVVRYMELGESIPIIENVLYMTSHRNRGAAWGMLQ GQFWLFYLITIVVVVGIVIYIQRLQPTQRLFGIALGLMLGGALGNFIDRIFRKEVVDFVH TYIFNYSFPIFNVADAALTIGVALMFIYTWTEEKQRKGMSDGANSTHD
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein Signal Peptidase (LspA) and why is it significant for bacterial research?

Lipoprotein Signal Peptidase (LspA) is a transmembrane aspartyl protease essential for lipoprotein maturation in bacteria. It cleaves the signal peptide from prolipoproteins after they have been modified with diacylglyceryl at the conserved cysteine residue. LspA is considered an ideal protein target for antimicrobial research because it meets several crucial criteria: it is required for viability across many bacterial species, is unique to prokaryotes (limiting potential side effects on host cells), and has robust assays available to quantitate activity and identify inhibitors . The study of LspA from thermophilic bacteria like Anoxybacillus flavithermus is particularly valuable for understanding protein stability under extreme conditions and for potential biotechnological applications.

How does the lipoprotein processing pathway function in bacteria like Anoxybacillus flavithermus?

The lipoprotein processing pathway in bacteria involves several sequential steps. First, prolipoproteins containing a characteristic signal peptide with a consensus lipobox [L(VI)−3-A(STVI)−2-G(AS)−1-C*+1] are transported across the cytoplasmic membrane . The lipobox cysteine is then modified by the addition of a diacylglyceryl (DAG) group. Following this modification, LspA recognizes the DAG-modified prolipoprotein and cleaves the signal peptide at the G-C* bond, where C* represents the DAG-modified cysteine . This cleavage is essential for proper lipoprotein localization and function. In thermophilic bacteria like Anoxybacillus flavithermus, these enzymes need to operate efficiently at higher temperatures, suggesting potential structural adaptations compared to mesophilic counterparts.

What methods are recommended for expression and purification of recombinant LspA?

For effective expression and purification of recombinant LspA, researchers should consider the following protocol: Express the protein with a His-tag in a bacterial system, harvest cells, and resuspend the membrane pellet in buffer . Solubilize the membrane protein using a detergent such as fos choline-12 (FC12) at approximately 1.8% (w/v) concentration, and rock at 4°C for at least one hour . Remove unsolubilized material via ultracentrifugation at 100,000g for 45 minutes. Purify using Ni²⁺ immobilized metal affinity chromatography, washing with buffer containing imidazole (around 40 mM) and FC12 (0.14% w/v) . Elute with higher imidazole concentration (approximately 300 mM) and remove imidazole using a desalting column. Concentrate the protein using a 10kDa molecular weight cutoff concentrator and verify purity using SDS-PAGE and mass spectrometry . For thermostable LspA from Anoxybacillus flavithermus, consider performing certain purification steps at elevated temperatures to select for properly folded protein.

What are the common challenges in working with membrane proteins like LspA?

Working with membrane proteins like LspA presents several challenges inherent to their hydrophobic nature. The primary difficulties include: achieving sufficient expression levels in heterologous systems; maintaining protein stability during extraction from the membrane; selecting appropriate detergents that preserve native protein conformation; preventing protein aggregation during concentration steps; and obtaining pure, homogeneous samples for structural studies. In particular, the amphipathic nature of LspA, with its multiple transmembrane helices, requires careful optimization of solubilization conditions. Researchers often need to screen multiple detergents to find conditions that yield functional protein, and the choice between detergent micelles, nanodiscs, or lipid cubic phase for downstream applications can significantly impact experimental outcomes . For thermophilic proteins like those from Anoxybacillus flavithermus, temperature stability during purification becomes an additional consideration.

How do the conformational dynamics of LspA contribute to its catalytic function?

Research using molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) spectroscopy has revealed that LspA exists in multiple conformational states that are critical to its function. Studies indicate that LspA samples at least three distinct conformations: closed, intermediate, and open . The open conformation is hypothesized to be the only state where the prolipoprotein substrate can sterically fit into the active site for signal peptide cleavage. Analysis of continuous wave (CW) line shapes and double electron-electron resonance (DEER) data suggests that LspA samples all three conformations in all states (apo, globomycin-bound, and myxovirescin-bound), but the population distribution varies depending on the state .

This conformational flexibility appears essential for the catalytic mechanism: the enzyme must open to accept the substrate, close to position the scissile bond next to the catalytic dyad aspartates, and then release the cleaved products. The signal peptide is thought to be accommodated in the membrane in the space created by orthogonally packed helices H2, H3, and H4, while the lipobox forms an extended peptide with the scissile G-C* bond positioned near the catalytic dyad . These molecular movements are likely regulated by interactions with both the membrane environment and the substrate itself.

What structural features distinguish LspA inhibitors and how can this information guide rational drug design?

Analysis of LspA inhibitors like globomycin and myxovirescin reveals distinct chemical structures that nonetheless target the same enzyme. Globomycin is a cyclic peptide containing a unique β-hydroxy fatty acid, while myxovirescin is a 28-membered macrolactam lactone . Despite their chemical differences, both effectively inhibit LspA activity.

Crystal structures of LspA in complex with these inhibitors provide valuable insights for rational drug design. The LspMrs-globomycin complex structure (PDB: 6RYO, resolution 1.92 Å) and LspMrs-myxovirescin complex structure (PDB: 6RYP, resolution 2.30 Å) reveal different binding modes . The globomycin structure suggests that segments like g.Leu-g.Ile-g.Ser mimic the lipobox sequence of the natural substrate . In contrast, myxovirescin's binding pose could not be predicted based on the globomycin complex, highlighting the diversity of potential inhibition mechanisms .

These structural differences suggest multiple approaches for developing new antibiotics targeting LspA. Drug design efforts could focus on either mimicking the natural substrate like globomycin does, or identifying novel binding interactions like those seen with myxovirescin. Comparing inhibitor potency between LspA orthologs (Table 1) can further guide optimization of lead compounds for broader spectrum activity.

How can researchers design effective high-throughput screening assays for LspA inhibitors?

Designing effective high-throughput screening (HTS) assays for LspA inhibitors requires careful consideration of assay format, substrate design, and detection methods. One successful approach involves Fluorescence Resonance Energy Transfer (FRET)-based assays that monitor proteolysis of synthetic substrates . In this methodology, researchers can use substrates containing an N-terminal fluorophore (such as Abz) and a C-terminal quencher (like nY-NH₂) . When LspA cleaves this substrate, the separation of fluorophore and quencher results in increased fluorescence that can be measured to quantify enzymatic activity.

For optimal HTS implementation, researchers should consider:

  • Substrate design: Create synthetic peptides that mimic the natural lipobox sequence [L(VI)−3-A(STVI)−2-G(AS)−1-C*+1], incorporating a diacylglyceryl-modified cysteine and appropriate fluorophore/quencher pairs .

  • Assay validation: Generate a standard curve using purified products to convert fluorescence changes into moles of substrate consumed. Verify linearity at the substrate concentrations used and ensure that inner filter effects are negligible (absorbance values should not exceed 0.08) .

  • Inhibitor testing: Screen compounds at multiple concentrations to generate dose-response curves and calculate IC₅₀ values using appropriate software like GraphPad Prism . Include known inhibitors like globomycin and myxovirescin as positive controls.

This approach has proven successful in screening large compound libraries; for example, one study employed their HTS assay against 646,275 compounds to discover novel LspA inhibitors, which were subsequently optimized to nanomolar potency .

What are the current methodological approaches for structural studies of LspA and how can they be optimized for Anoxybacillus flavithermus LspA?

Structural studies of LspA employ multiple complementary approaches, each with specific advantages for understanding different aspects of this membrane protein. For Anoxybacillus flavithermus LspA specifically, researchers should consider these optimized methods:

  • X-ray Crystallography: The lipid cubic phase (LCP) method has successfully yielded high-resolution structures of LspA from various organisms, including 1.92 Å and 2.30 Å structures of LspMrs in complex with inhibitors . For Anoxybacillus flavithermus LspA, consider using monoolein as the host lipid and screen various crystallization conditions that accommodate thermostable proteins. Crystal packing analysis indicates that P3₂21 and P6₁22 space groups have been successful for LspA crystallization .

  • Molecular Dynamics (MD) Simulations: MD simulations have proven valuable for understanding LspA conformational dynamics. For Anoxybacillus flavithermus LspA, researchers should construct a simulation system with the protein embedded in a mixed lipid bilayer (such as POPG:POPE at 1:4 mole ratio), apply an elastic network between backbone beads, and simulate for at least 200 ns at elevated temperatures (e.g., 310-330 K) to reflect its thermophilic nature .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Site-directed spin labeling coupled with EPR has revealed important conformational states of LspA. For the thermostable Anoxybacillus flavithermus variant, introduce cysteine mutations at key positions and label with MTSL/R1 spin label. Continuous wave (CW) and DEER experiments should be performed to detect multiple conformational states .

  • Computational Docking: For substrate binding studies, docking programs like HADDOCK can model interactions between LspA and prolipoproteins. Define active residues in transmembrane helices H1-H3 and the extracellular loop, as well as the signal peptide region of the substrate .

What protocols are recommended for analyzing LspA enzyme kinetics and inhibition?

For comprehensive analysis of LspA enzyme kinetics and inhibition, researchers should implement a multi-method approach:

  • FRET-based Assay: Utilize synthetic FRET substrates (e.g., Abz-LALAGCSS-nY-NH₂) where C represents a diacylglyceryl-modified cysteine. Monitor fluorescence increase (excitation: 320 nm, emission: 420 nm) as a function of time to directly measure proteolytic activity . To determine kinetic parameters:

    • Measure initial reaction rates at varying substrate concentrations

    • Generate Michaelis-Menten plots and calculate Km and kcat values

    • For inhibition studies, perform assays with varying inhibitor concentrations to determine IC₅₀ values

  • Gel-shift Assay: This complementary method uses a prolipoprotein substrate (like proICP) and visualizes cleavage by SDS-PAGE. The mature protein shows increased mobility compared to the prolipoprotein, allowing quantification of activity based on band intensity . This approach is particularly useful for confirming results from FRET assays and evaluating inhibitor potency under near-physiological conditions.

  • Data Analysis: Convert fluorescence units to moles of product using standard curves generated with purified cleavage products. Calculate specific activity values (μmol min⁻¹ mg⁻¹) and determine inhibition parameters using nonlinear regression in software like GraphPad Prism . Always verify that inner filter effects are negligible by ensuring substrate absorbance values remain below 0.06 at 320 nm and 0.02 at 420 nm .

  • Temperature Considerations: For Anoxybacillus flavithermus LspA specifically, conduct assays at elevated temperatures (50-60°C) to reflect the thermophilic nature of this organism and obtain physiologically relevant kinetic parameters.

How can researchers effectively compare LspA from different bacterial species, including Anoxybacillus flavithermus?

Effective comparison of LspA from different bacterial species requires a systematic approach examining multiple protein characteristics. For including Anoxybacillus flavithermus LspA in comparative studies, consider these methodological approaches:

  • Sequence and Structural Analysis:

    • Perform multiple sequence alignment to identify conserved catalytic residues and species-specific variations

    • Compare predicted transmembrane topology using programs like TMHMM or TOPCONS

    • Generate homology models based on available crystal structures (e.g., LspMrs, PDB: 6RYO/6RYP)

    • Analyze conservation of key structural elements like the catalytic dyad aspartates and the β-cradle region

  • Biochemical Characterization:

    • Express and purify each LspA ortholog using standardized protocols

    • Compare thermal stability profiles, particularly relevant for thermophilic Anoxybacillus flavithermus LspA

    • Determine optimum pH, temperature, and detergent conditions for activity

    • Measure kinetic parameters (Km, kcat, kcat/Km) using identical FRET substrates

  • Inhibitor Sensitivity Profiles:

    • Test sensitivity to known inhibitors like globomycin and myxovirescin

    • Compare IC₅₀ values across species as shown in this comparative table:

LspA SourceGlobomycin IC₅₀ (nM)Myxovirescin IC₅₀ (nM)Assay Method
S. aureus (LspMrs)82.5 ± 12.497.3 ± 7.6FRET
P. aeruginosa (LspPae)320 ± 31.2135 ± 15.2FRET
A. flavithermus (theoretical)UnknownUnknown-
  • Functional Complementation:

    • Create knockout strains where endogenous LspA is deleted

    • Test whether heterologous expression of different LspA orthologs can restore viability

    • Analyze growth phenotypes under various stress conditions

These methodological approaches enable systematic comparison of functional and structural characteristics across different bacterial LspA enzymes, providing insights into species-specific adaptations and potential relevance for antibiotic development.

What techniques are most effective for analyzing LspA-membrane interactions and conformational changes?

Analyzing LspA-membrane interactions and conformational changes requires specialized techniques that can probe protein dynamics in a lipid environment. The most effective approaches include:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling with MTSL/R1 at strategically selected residues throughout LspA

    • Continuous wave (CW) EPR to detect mobility changes and local environment

    • Double Electron-Electron Resonance (DEER) to measure distances between labeled sites and identify discrete conformational states

    • Analysis of EPR data to determine population distributions of different conformational states (closed, intermediate, and open)

  • Molecular Dynamics (MD) Simulations:

    • Construct systems with LspA embedded in mixed lipid bilayers that mimic bacterial membranes (e.g., POPG:POPE at 1:4 ratio)

    • Apply appropriate force fields for protein-lipid interactions

    • Extended simulations (≥200 ns) to capture relevant conformational transitions

    • Analysis of protein-lipid contacts, membrane deformation, and conformational changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Monitor deuterium uptake in different regions of LspA in various conditions

    • Identify dynamic regions and conformational changes upon substrate or inhibitor binding

    • Detect differences in dynamics between LspA from mesophilic and thermophilic organisms

  • Fluorescence Spectroscopy:

    • Introduce fluorescent labels at key positions through site-directed mutagenesis

    • Monitor changes in fluorescence intensity or anisotropy upon substrate binding or inhibitor addition

    • Use FRET pairs to measure intramolecular distances during conformational changes

  • Lipid Cubic Phase (LCP) Crystallography:

    • Crystallize LspA in monoolein-based mesophases that maintain a membrane-like environment

    • Analyze positions of co-crystallized lipid molecules to identify specific protein-lipid interactions

    • Compare structures with different bound ligands to capture distinct conformational states

These complementary techniques provide a comprehensive view of how LspA interacts with the membrane environment and undergoes conformational changes during its catalytic cycle.

How can structural knowledge of LspA be applied to develop novel antibiotics with reduced resistance potential?

Structural knowledge of LspA provides several strategic avenues for developing novel antibiotics with reduced resistance potential. LspA represents an ideal antibacterial target due to its essential role in bacterial viability across many species, its absence in eukaryotic cells (limiting host toxicity), and the availability of robust assays to quantify activity . To leverage this knowledge for antibiotic development:

  • Structure-Based Drug Design: Crystal structures of LspA in complex with inhibitors like globomycin (PDB: 6RYO) and myxovirescin (PDB: 6RYP) reveal distinct binding modes that can guide rational design . Researchers can identify critical interaction points at the active site, particularly focusing on the catalytic aspartate dyad and the β-cradle region that accommodates the diacylglyceryl moiety of substrates .

  • Targeting Multiple Conformational States: EPR and MD studies have revealed that LspA samples at least three conformations (closed, intermediate, and open) . Designing inhibitors that stabilize non-catalytic conformations could provide an alternative inhibition mechanism less susceptible to resistance mutations.

  • Combination Approaches: Since LspA inhibition leads to accumulation of prolipoproteins in the cell membrane, combining LspA inhibitors with compounds that target other steps in lipoprotein processing or membrane integrity could create synergistic effects that reduce resistance development.

  • Broad-Spectrum Optimization: Comparative analysis of LspA from different bacterial species, including thermophilic organisms like Anoxybacillus flavithermus, can identify conserved structural features that may be targeted for broad-spectrum activity. The ability of compounds like myxovirescin to inhibit LspA from both Gram-positive and Gram-negative bacteria suggests this approach is feasible .

High-throughput screening using FRET-based assays has already identified inhibitors with nanomolar IC₅₀ values , demonstrating the practical application of these strategies for discovering novel antibacterial agents with distinct mechanisms of action.

How might the thermostable properties of Anoxybacillus flavithermus LspA be leveraged for biotechnological applications?

The thermostable properties of Anoxybacillus flavithermus LspA present several unique opportunities for biotechnological applications beyond basic research:

  • Enzyme-Based Biosensors: The stability of thermophilic LspA at elevated temperatures makes it an excellent candidate for developing robust biosensors for environmental monitoring or detection of specific bacterial lipoproteins. Such biosensors could operate under harsh conditions where mesophilic enzymes would denature.

  • Biocatalysis in Industrial Processes: Thermostable enzymes allow reactions to be conducted at higher temperatures, which can increase substrate solubility, reduce viscosity, and decrease risk of microbial contamination. LspA's proteolytic activity against specific signal peptide sequences could be harnessed for specialized peptide modifications in biotechnology processes.

  • Structural Studies Platform: The inherent stability of thermostable proteins often facilitates crystallization and structural determination. Anoxybacillus flavithermus LspA could serve as a more stable scaffold for structure-based studies of membrane protein dynamics, potentially revealing conformational states difficult to capture with less stable orthologs .

  • Protein Engineering Template: The structural features that confer thermostability to Anoxybacillus flavithermus LspA could inform protein engineering efforts to improve stability of other membrane proteins for various applications. Comparative analysis with mesophilic LspA orthologs might reveal key stabilizing interactions that could be transferred to other systems.

  • Thermostable Protein Production System: The signal peptide recognition and processing capabilities of thermostable LspA could be integrated into expression systems designed for the production of recombinant lipoproteins at elevated temperatures, potentially improving yield and purity in industrial protein production.

These applications leverage the unique properties of thermostable enzymes while taking advantage of LspA's specific function in lipoprotein processing.

What are the methodological considerations for studying LspA inhibition in whole-cell and ex vivo infection models?

Studying LspA inhibition in whole-cell and ex vivo infection models requires careful methodological considerations to bridge the gap between biochemical assays and potential therapeutic applications. Researchers should address:

  • Compound Permeability: LspA is a membrane-embedded enzyme with its active site facing the extracellular space in Gram-positive bacteria or the periplasm in Gram-negative bacteria . For Gram-negative pathogens, inhibitors must cross the outer membrane, which often requires permeabilization strategies or structural modifications. Studies have shown that LspA inhibitors like globomycin are more effective against E. coli when combined with outer-membrane permeabilizers like PMBN .

  • Infection Model Selection: Ex vivo infection studies, as performed with MRSA, can assess whether LspA activity is important for bacterial survival during human infection . Consider tissue types relevant to the pathogen of interest and ensure models reflect physiological conditions including temperature, which is particularly relevant for thermophilic bacteria like Anoxybacillus flavithermus.

  • Genetic Controls: Generate conditional LspA knockout or depletion strains to validate that observed effects of inhibitors are due to on-target activity. Complementation with LspA variants carrying resistance mutations can further confirm mechanism of action.

  • Phenotypic Readouts: Since LspA inhibition affects lipoprotein processing, researchers should monitor:

    • Accumulation of unprocessed prolipoproteins via Western blotting

    • Membrane integrity changes through permeability assays

    • Alterations in cell morphology via microscopy

    • Bacterial survival in relevant infection conditions

    • Host immune response parameters in ex vivo models

  • Pharmacokinetic/Pharmacodynamic Parameters: Establish the relationship between inhibitor concentration, LspA inhibition, and antibacterial effect. Determine minimum inhibitory concentrations (MICs) and compare with biochemical IC₅₀ values to assess cellular penetration and target engagement.

These methodological considerations ensure that promising LspA inhibitors identified through biochemical screening can be effectively evaluated in more complex biological systems, advancing their development as potential therapeutic agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.