Recombinant Anoxybacillus flavithermus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Aflv_2693; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Target Names
nuoK
Target Protein Sequence
MSVPLSAYLVFALMLFCIGLYGALTKRNTVIVLICIELMLNAVNVNLVAFSKYGMNPGIT GQVFSLFTITVAAAEAAVGLAILIALYRNRKTIHIDEVDSMKR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be a menaquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and its role in Anoxybacillus flavithermus?

NADH-quinone oxidoreductase subunit K (nuoK) is an integral membrane protein component of the respiratory complex I (NDH-1) in Anoxybacillus flavithermus. This protein functions as part of the proton-translocating NADH-quinone oxidoreductase complex, which catalyzes the reduction of quinone using NADH as an electron donor . The protein consists of 103 amino acids with the sequence: "MSVPLSAYLVFALMLFCIGLYGALTKRNTVIVLICIELMLNAVNVNLVAFSKYGMNPGITGQVFSLFTITVAAAEAAVGLAILIALYRNRKTIHIDEVDSMKR" . In the complete NDH-1 complex, nuoK is positioned within the membrane arm alongside subunits NuoA, NuoH, NuoJ, NuoL, NuoM, and NuoN . While the precise function of nuoK remains under investigation, its high conservation across species suggests a critical role in either the structural stability of the complex or the proton translocation mechanism. In A. flavithermus, a thermophilic bacterium, nuoK likely contributes to the thermal stability of the respiratory complex, allowing the organism to maintain energy metabolism at elevated temperatures.

What is the structure and localization of nuoK in the NADH-quinone oxidoreductase complex?

NuoK is a hydrophobic transmembrane protein positioned within the membrane arm of the L-shaped NDH-1 complex. Based on structural studies of homologous proteins, nuoK spans the membrane with multiple transmembrane helices . The complete NDH-1 complex consists of 14 subunits (NuoA-NuoN), which are organized into two major domains: the peripheral arm projecting into the cytoplasm (containing NuoB, NuoC, NuoD, NuoE, NuoF, NuoG, and NuoI) and the membrane arm embedded in the lipid bilayer (containing NuoA, NuoH, NuoJ, NuoK, NuoL, NuoM, and NuoN) . While the peripheral arm contains most of the redox centers (including FMN and multiple iron-sulfur clusters), the membrane arm, including nuoK, is involved in proton translocation. Recent structural analyses suggest that nuoK interacts closely with other membrane subunits, particularly NuoH, which appears to extend a cytoplasmic loop toward the peripheral arm, potentially forming a central structural connection between the two domains . This positioning places nuoK in a strategic location for participating in the conformational changes that couple electron transfer to proton translocation.

How does nuoK compare to homologous proteins in other bacterial species?

The nuoK protein exhibits high sequence conservation across diverse bacterial species, reflecting its essential role in NADH-quinone oxidoreductase function. When comparing A. flavithermus nuoK with homologs from other species, the transmembrane regions show particularly high conservation, suggesting strong evolutionary constraints on the protein's structure within the membrane. The closest homologs are found in other thermophilic Bacillaceae, but significant similarity exists even with mesophilic counterparts like those in Escherichia coli.

Comparative analysis reveals that nuoK counterparts are present in both prokaryotic NDH-1 and mitochondrial complex I, indicating its fundamental importance in respiratory electron transport. The E. coli NuoK has been more extensively studied and has been shown to be essential for complex assembly and function . In Thermus thermophilus, structural studies have placed the NuoK homolog (Nqo11) in close association with other membrane subunits, contributing to proton channels within the membrane domain. The thermophilic nature of A. flavithermus nuoK may confer adaptations that maintain protein stability and function at elevated temperatures, making comparative studies particularly valuable for understanding protein thermostability mechanisms in membrane-bound enzymes.

What are the optimal conditions for expression and purification of recombinant Anoxybacillus flavithermus nuoK?

Recombinant expression of A. flavithermus nuoK presents challenges typical of membrane proteins but can be successfully achieved with appropriate strategies. Based on established protocols for similar proteins, the following approach is recommended:

Expression System:
E. coli is the preferred expression host for recombinant A. flavithermus nuoK, as demonstrated in the commercial preparation . BL21(DE3) or C43(DE3) strains (the latter specifically engineered for membrane protein expression) typically yield better results.

Expression Conditions:

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Post-induction temperature: 18-25°C (lower temperatures often improve membrane protein folding)

  • Duration: 16-20 hours

  • Media supplementation: 1% glucose can help reduce basal expression

Purification Protocol:

  • Cell lysis: French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane isolation: Ultracentrifugation at 100,000 × g for 1 hour

  • Membrane solubilization: 1-2% n-dodecyl-β-D-maltoside (DDM) or other mild detergents like LMNG

  • Affinity purification: Ni-NTA chromatography for His-tagged protein

  • Size exclusion chromatography: Final purification step to obtain homogeneous protein

Storage Considerations:
The protein should be stored in buffer containing 10-20 mM Tris/PBS pH 8.0 with 0.05% detergent and 6% trehalose . Aliquoting and flash-freezing in liquid nitrogen is recommended, as repeated freeze-thaw cycles should be avoided .

How can researchers assess the functional integrity of purified recombinant nuoK?

Assessing the functional integrity of purified recombinant nuoK requires multiple approaches, as the protein functions as part of the larger NDH-1 complex:

Biophysical Characterization:

  • Circular dichroism (CD) spectroscopy to confirm proper secondary structure (predominantly α-helical)

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify monodispersity and proper oligomeric state

  • Thermal shift assays to evaluate protein stability and proper folding

Reconstitution Studies:

  • Proteoliposome reconstitution: Incorporation of purified nuoK into liposomes containing phospholipids (typically E. coli polar lipids mixed with phosphatidylcholine)

  • Assembly assays: Co-reconstitution with other NDH-1 subunits to assess ability to form sub-complexes

Functional Assays:
While isolated nuoK does not have enzymatic activity, researchers can assess:

  • Binding studies with other NDH-1 subunits using co-immunoprecipitation or surface plasmon resonance

  • Proton translocation capability after reconstitution into proteoliposomes using pH-sensitive fluorophores

  • Complementation assays in nuoK-knockout bacterial strains to assess in vivo functionality

Structural Integrity Assessment:

  • Limited proteolysis to verify proper folding (properly folded membrane proteins show characteristic protease-resistant fragments)

  • Detergent screening using thermal stability assays to identify optimal conditions for maintaining native-like structure

What assays are available to measure nuoK activity in isolated membranes?

While nuoK itself does not possess independent enzymatic activity, researchers can assess the activity of the NDH-1 complex containing nuoK using the following methods with isolated membrane preparations:

NADH Oxidation Assays:

  • dNADH oxidase activity: Measures the physiological activity of NDH-1 by monitoring the decrease in absorbance at 340 nm as dNADH is oxidized. Standard conditions include 10 mM potassium phosphate buffer (pH 7.0), 1 mM EDTA, and 150 μM dNADH at 30°C .

  • dNADH-DB reductase activity: Measures the electron transfer to the artificial electron acceptor decylubiquinone (DB). The reaction mixture typically contains 10 mM potassium phosphate (pH 7.0), 1 mM EDTA, 10 mM KCN (to inhibit downstream respiration), 60 μM DB, and 150 μM dNADH .

  • dNADH-K3Fe(CN)6 reductase activity: This assay measures electron transfer to ferricyanide, which accepts electrons directly from the NADH dehydrogenase module. The decrease in absorbance is monitored at 420 nm in a buffer containing 10 mM potassium phosphate (pH 7.0), 1 mM EDTA, 10 mM KCN, and 1 mM K3Fe(CN)6 .

Proton Translocation Measurements:

  • Membrane potential generation: Can be monitored using potential-sensitive dyes like oxonol VI. The assay is performed at 30°C with membrane samples in 50 mM MOPS (pH 7.3), 10 mM MgCl2, 50 mM KCl buffer containing 2 μM oxonol VI, and absorbance changes at 630-603 nm are recorded after addition of 200 μM dNADH .

  • Proton pumping activity: Can be measured using ACMA (9-amino-6-chloro-2-methoxyacridine) fluorescence quenching, which is sensitive to ΔpH across membranes. The uncoupler FCCP (2 μM) can be used to dissipate the membrane potential and confirm the specificity of the signal .

Inhibitor Sensitivity:
Specific inhibitors like Cap-40 (at 10 μM concentration) can be used to confirm that the measured activities are specifically linked to energy-transducing NDH-1 activity rather than alternative NADH dehydrogenases .

How does nuoK contribute to the proton-translocating mechanism of NADH-quinone oxidoreductase?

NuoK plays a crucial role in the proton-translocating mechanism of NADH-quinone oxidoreductase, although the precise details continue to be investigated. Current evidence suggests the following contributions:

Proton Channel Formation:
NuoK is believed to contribute to forming one of the proton translocation pathways within the membrane domain of NDH-1. The transmembrane helices of nuoK likely align with helices from other membrane subunits to create hydrophilic channels through which protons can pass across the otherwise hydrophobic membrane environment. Based on studies of homologous subunits, conserved charged residues (particularly glutamate and aspartate) within the transmembrane regions may participate directly in proton binding and transfer .

Conformational Coupling:
NuoK is positioned strategically within the membrane arm, potentially participating in the long-range conformational changes that couple electron transfer in the peripheral arm to proton translocation in the membrane domain. The energy released during electron transfer from NADH to quinone drives conformational changes that propagate through the complex, with nuoK serving as one of the mechanical components that converts these structural shifts into proton movement .

Structural Support:
While not directly involved in electron transfer, nuoK provides essential structural support for the membrane domain architecture. Studies on other NDH-1 subunits have shown that highly conserved charged residues are often involved in subunit-subunit interactions that maintain the integrity of the complex . NuoK likely participates in such interactions, potentially with the NuoH subunit, which appears to form a central connection between the peripheral and membrane domains.

Quinone Binding Site Contribution:
Although the primary quinone binding site is associated with the NuoD subunit, the proximity of nuoK to this region suggests it may influence the environment of the quinone binding pocket or participate in proton delivery to/from this site during the catalytic cycle.

What structural features of nuoK are essential for its function?

Several structural features of nuoK are critical for its proper function within the NADH-quinone oxidoreductase complex:

Transmembrane Helices:
The hydrophobic transmembrane helices of nuoK are essential for its proper insertion into the membrane and positioning within the complex. The amino acid sequence "MSVPLSAYLVFALMLFCIGLYGALTKRNTVIVLICIELMLNAVNVNLVAFSKYGMNPGITGQVFSLFTITVAAAEAAVGLAILIALYRNRKTIHIDEVDSMKR" reveals multiple hydrophobic stretches characteristic of transmembrane domains . These helices are not merely anchors but form part of the proton translocation machinery.

Conserved Charged Residues:
Although nuoK is predominantly hydrophobic, it contains several highly conserved charged residues that are critical for function. By analogy with studies on the NuoC subunit, where mutations of conserved acidic residues (Glu-138, Glu-140, and Asp-143) completely abolished activity , similar conserved charged residues in nuoK likely serve essential roles in proton translocation and/or subunit interactions.

Interhelical Loop Regions:
The loops connecting transmembrane helices often contain functionally important residues that can interact with other subunits or participate in conformational changes. By comparison with other membrane subunits like NuoH, where cytoplasmic loops were shown to be important for interactions with peripheral subunits , the loop regions of nuoK may similarly mediate important interactions.

Terminal Regions:
The N- and C-terminal regions of nuoK may extend beyond the membrane and interact with other subunits or domains of the complex. These regions often contain charged or polar residues that participate in ionic interactions stabilizing the quaternary structure of the complex.

Conserved Motifs:
Sequence alignment of nuoK across species reveals conserved motifs that likely serve essential structural or functional roles. While specific motifs for nuoK have not been explicitly described in the provided search results, by analogy with other NDH-1 subunits, such conserved regions typically indicate functional importance.

How do mutations in conserved residues affect the assembly and function of nuoK in the complex?

Mutations in conserved residues of nuoK can profoundly impact both the assembly and function of the NADH-quinone oxidoreductase complex. While specific mutagenesis studies on A. flavithermus nuoK are not detailed in the provided search results, inferences can be drawn from studies on other NDH-1 subunits:

Effects on Complex Assembly:

  • Complete assembly failure: Mutations in critical residues can prevent the proper assembly of the entire complex. For example, mutations in the conserved acidic residues (Glu-138, Glu-140, and Asp-143) of the NuoC subunit completely abolished the assembly of the E. coli NDH-1 complex .

  • Subcomplexes formation: Some mutations may allow partial assembly, resulting in stable subcomplexes that lack some subunits. This can be detected through blue-native gel electrophoresis, which separates protein complexes in their native state .

  • Altered stability: Even when assembly is achieved, mutations can reduce the stability of the complex, leading to increased susceptibility to degradation or disassembly during purification or functional studies.

Functional Consequences:

  • Energy-transducing activities: Mutations in conserved residues often lead to reduced or abolished energy-transducing activities, such as dNADH oxidase and dNADH-DB reductase activities, while non-energy-transducing activities like dNADH-K3Fe(CN)6 reductase may remain partially intact .

  • Proton translocation deficiency: Mutations in residues involved in proton channels can specifically impair proton pumping while maintaining electron transfer, resulting in uncoupled enzymes that consume NADH but fail to generate a proton gradient.

  • Altered inhibitor sensitivity: Some mutations can change the sensitivity to specific inhibitors, providing insights into the roles of particular residues in inhibitor binding sites or conformational coupling mechanisms.

Experimental Approaches to Study nuoK Mutations:

  • Site-directed mutagenesis targeting conserved residues

  • Chromosomal gene manipulation techniques similar to those used for NuoC studies

  • Activity measurements of mutants using the assays described in section 2.3

  • Blue-native gel electrophoresis to assess complex assembly

  • Immunoblotting to detect the presence and stability of individual subunits

How can cryo-EM be utilized to elucidate the structural interactions of nuoK?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane protein complexes like NADH-quinone oxidoreductase. For investigating nuoK structural interactions, researchers can apply the following cryo-EM approaches:

Single Particle Analysis of Intact Complex:

  • Sample preparation: Purify intact NDH-1 complex containing nuoK in detergent micelles or nanodiscs, apply to EM grids, and flash-freeze in liquid ethane.

  • Data collection: Collect images on a high-end electron microscope (e.g., Titan Krios) equipped with a direct electron detector and energy filter.

  • Data processing: Use software packages like RELION, cryoSPARC, or EMAN2 to process images, perform 2D classification, generate 3D reconstructions, and refine structures.

  • Resolution enhancement: Apply techniques like particle subtraction and focused refinement to improve resolution around the nuoK region, which might otherwise be limited due to the flexibility of the membrane domain.

Cross-linking Mass Spectrometry Integration:

  • Perform chemical cross-linking of purified complex using MS-cleavable cross-linkers

  • Digest cross-linked complex and analyze by LC-MS/MS

  • Identify cross-linked peptides to map interaction surfaces

  • Integrate cross-linking constraints with cryo-EM density to validate and refine the structural model

Comparative Structure Analysis:
Compare the structure of A. flavithermus NDH-1 with available structures from other organisms, such as the 3D structural model of Thermus NDH-1 (PDB codes: 3FUG, 3IAS), where the Nqo8/NuoH subunit was observed to be located almost directly beneath the Nqo4+5/NuoCD subunit, forming a central core connecting the two domains .

Mutagenesis-Guided Structural Analysis:

  • Generate point mutations in conserved residues of nuoK

  • Analyze structural consequences by cryo-EM

  • Compare wild-type and mutant structures to identify conformational changes

  • Correlate structural alterations with functional effects

Time-Resolved Cryo-EM:
Apply emerging time-resolved cryo-EM techniques to capture different conformational states of the complex during the catalytic cycle, potentially revealing dynamic interactions involving nuoK that are critical for energy transduction.

What are the current challenges in studying the conformational dynamics of nuoK?

Studying the conformational dynamics of nuoK presents several significant challenges:

Membrane Environment Complexity:

  • Native lipid interactions: The function of nuoK likely depends on specific interactions with membrane lipids, which are difficult to maintain in purified systems.

  • Detergent effects: Detergents used for solubilization can alter protein conformations and dynamics compared to the native membrane environment.

  • Reconstitution limitations: Reconstituting nuoK into artificial membranes may not fully recapitulate the native lipid composition and lateral pressure profiles.

Technical Limitations:

  • Time resolution: Most structural techniques provide static snapshots rather than continuous dynamic information, making it difficult to capture transient conformational states.

  • Size constraints: The small size of nuoK (103 amino acids) makes it challenging to study in isolation by techniques like NMR.

  • Signal-to-noise challenges: Detecting conformational changes in a single subunit within the large NDH-1 complex requires exceptional signal specificity.

Integration with the Complex:

  • Interdependence: Conformational changes in nuoK are likely coupled to changes in other subunits, making it difficult to isolate nuoK-specific dynamics.

  • Assembly requirements: Proper folding and dynamics of nuoK may depend on interactions with other subunits, complicating studies of the isolated protein.

  • Functional coupling: Correlating observed conformational changes with specific steps in the proton translocation mechanism requires synchronized measurements of structure and function.

Methodological Approaches to Address These Challenges:

TechniqueAdvantagesLimitationsPotential Insights
Site-specific spin labeling EPRCan detect conformational changes in membrane proteinsRequires introduction of labels that may perturb functionDistance changes between specific residues during catalysis
Hydrogen-deuterium exchange MSMaps solvent accessibility changesLimited time resolutionIdentification of dynamic regions and interaction interfaces
Single-molecule FRETCan observe rare or transient statesRequires fluorescent labelingConformational distributions and transitions
Molecular dynamics simulationsAtomic-level detail of dynamicsComputational limitations for long timescalesPrediction of conformational changes and energy landscapes
Solid-state NMRCan study membrane proteins in lipid environmentsSignal overlap in large complexesLocal structural changes and water accessibility

How does nuoK adaptation in thermophilic A. flavithermus provide insights into enzyme thermostability?

The nuoK subunit from the thermophilic bacterium Anoxybacillus flavithermus offers valuable insights into mechanisms of protein thermostability, particularly for membrane proteins:

Sequence-Based Adaptations:
Analysis of the A. flavithermus nuoK sequence "MSVPLSAYLVFALMLFCIGLYGALTKRNTVIVLICIELMLNAVNVNLVAFSKYGMNPGITGQVFSLFTITVAAAEAAVGLAILIALYRNRKTIHIDEVDSMKR" reveals features associated with thermostability:

  • Amino acid composition: Increased prevalence of hydrophobic and aromatic residues that enhance hydrophobic packing

  • Charged residue distribution: Strategic placement of charged residues that can form ionic networks stabilizing the tertiary structure

  • Reduced loop regions: Potentially shorter or more rigid loop regions compared to mesophilic homologs, reducing flexibility and potential denaturation sites

Structural Adaptations:

  • Transmembrane helix packing: Tighter packing of transmembrane helices through enhanced van der Waals contacts and interhelical hydrogen bonds

  • Lipid interactions: Adaptations in lipid-facing residues to accommodate the more rigid membranes typical of thermophilic organisms

  • Subunit interfaces: Stronger interactions at subunit interfaces, potentially involving additional salt bridges or hydrophobic contacts

Comparative Studies and Applications:
Comparing A. flavithermus nuoK with mesophilic homologs can guide protein engineering efforts:

  • Thermostability transfer: Identification of stabilizing elements that could be transferred to mesophilic proteins to enhance their thermal stability

  • Structure-guided mutations: Design of mutations to increase thermostability of industrial enzymes

  • Evolutionary insights: Understanding of natural selection pressures driving thermal adaptation in membrane proteins

Research Approaches:

  • Chimeric proteins: Creating chimeras between thermophilic and mesophilic nuoK to identify regions critical for thermostability

  • Thermal denaturation studies: Comparing unfolding profiles of wild-type and mutant proteins using techniques like differential scanning calorimetry

  • Molecular dynamics simulations: Computational analysis of dynamics at different temperatures to identify stabilizing interactions

  • In vitro evolution: Directed evolution experiments to identify additional stabilizing mutations

How can researchers address insolubility issues with recombinant nuoK?

Membrane proteins like nuoK frequently present insolubility challenges during recombinant expression and purification. The following strategies can help overcome these issues:

Expression Optimization:

  • Reduced expression rates: Lower IPTG concentrations (0.1-0.3 mM) and reduced growth temperatures (16-20°C) slow protein production, allowing more time for proper membrane insertion.

  • Specialized expression strains: Use E. coli strains specifically designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), which have adaptations to accommodate membrane protein overexpression.

  • Codon optimization: Adjust the coding sequence for optimal codon usage in the expression host while maintaining the amino acid sequence.

  • Fusion partners: Express nuoK with solubilizing fusion partners like MBP (maltose-binding protein) or SUMO, with appropriate protease cleavage sites for subsequent removal.

Solubilization Strategies:

  • Detergent screening: Systematically test multiple detergents across different classes (maltosides, glucosides, neopentyl glycols, etc.) to identify optimal conditions for nuoK extraction from membranes.

  • Mixed micelle approach: Use combinations of detergents that can synergistically improve solubilization while maintaining native-like environments.

  • Lipid addition: Include specific lipids during solubilization to stabilize the native structure.

Buffer Optimization:

  • pH screening: Test different pH conditions (typically pH 6.5-8.5) to find optimal stability.

  • Salt concentration: Optimize ionic strength (typically 100-500 mM NaCl) to reduce aggregation.

  • Stabilizing additives: Include glycerol (10-20%), specific lipids, or mild stabilizers like NDSB compounds.

Alternative Approaches:

  • Cell-free expression: Use cell-free systems with supplied detergents or lipids for direct incorporation of synthesized protein into micelles or liposomes.

  • Synthetic peptide approach: For small proteins like nuoK (103 amino acids) , chemical synthesis and subsequent refolding may be feasible.

  • Co-expression with partner subunits: Express nuoK together with interacting subunits to promote proper folding and complex formation.

Diagnostic Tools for Insolubility Issues:

  • In-gel fluorescence: Use GFP fusions to monitor folding and membrane insertion efficiency.

  • FSEC (Fluorescence-detection Size Exclusion Chromatography): Assess protein monodispersity in different detergents without extensive purification.

  • Western blotting with conformation-specific antibodies: Distinguish between properly folded and misfolded protein populations.

What strategies help overcome difficulties in reconstituting functional nuoK into proteoliposomes?

Reconstituting membrane proteins like nuoK into proteoliposomes presents specific challenges that require careful methodological approaches:

Lipid Composition Optimization:

  • Native-like mixtures: Use lipid compositions that mimic the native membrane environment of A. flavithermus, potentially including more rigid lipids suitable for thermophilic organisms.

  • Systematic screening: Test various combinations of phospholipids, including variations in headgroups (PC, PE, PG, cardiolipin) and acyl chain lengths.

  • Cholesterol or ergosterol addition: Include sterols to modulate membrane fluidity and thickness.

Reconstitution Methods:

  • Detergent removal techniques:

    • Dialysis: Gentle but time-consuming removal of detergent

    • Bio-beads: Faster detergent removal with adjustable kinetics

    • Cyclodextrin complexation: Selective removal of specific detergents

  • Protein-to-lipid ratio optimization: Test different ratios (typically ranging from 1:50 to 1:2000 w/w) to achieve optimal protein density.

  • Temperature control: Perform reconstitution at temperatures that maintain protein stability while allowing efficient incorporation (particularly important for thermophilic proteins).

Co-reconstitution Approaches:

  • Subcomplex reconstitution: Co-reconstitute nuoK with interacting subunits rather than attempting to incorporate it alone.

  • Sequential incorporation: Add subunits in a specific order that mimics the natural assembly process.

  • Complete complex incorporation: Purify and reconstitute the entire NDH-1 complex to maintain all subunit interactions.

Functional Verification:

  • Orientation control: Use techniques like freeze-fracture electron microscopy or accessibility assays to verify uniform protein orientation.

  • Proton permeability assays: Measure pH-sensitive fluorescence quenching using dyes like ACMA to verify proton translocation capability.

  • Patch-clamp electrophysiology: For detailed characterization of proton channel properties in reconstituted proteoliposomes.

Troubleshooting Reconstitution Problems:

ProblemPossible CausesSolutions
Poor incorporation efficiencyDetergent removal too fast or too slowAdjust removal kinetics; try different methods
Loss of activityProtein denaturation during reconstitutionInclude stabilizers; optimize temperature
Heterogeneous vesiclesSuboptimal lipid composition or hydrationStandardize preparation with extrusion or sonication
Random protein orientationLack of directional driving forceUse pH or ionic gradients during reconstitution
Leaky vesiclesIncomplete vesicle sealingOptimize freeze-thaw cycles; control detergent removal rate

How can researchers distinguish between direct and indirect effects of nuoK mutations on complex assembly?

Distinguishing direct from indirect effects of nuoK mutations on NDH-1 complex assembly requires a multi-faceted experimental approach:

Complementation and Suppressor Analysis:

  • Second-site suppressor screening: Identify compensatory mutations in other subunits that restore function in nuoK mutants, revealing functional interactions.

  • Cross-species complementation: Test whether nuoK from related species can functionally replace mutated A. flavithermus nuoK, highlighting conserved versus species-specific interactions.

  • Domain swapping: Create chimeric proteins between mutant and wild-type nuoK to identify specific regions responsible for assembly defects.

Staged Assembly Analysis:

  • Subcomplexes characterization: Use techniques like blue-native PAGE and immunoprecipitation to identify which subcomplexes form or fail to form with mutant nuoK .

  • Assembly kinetics: Monitor the time course of complex assembly using pulse-chase experiments coupled with co-immunoprecipitation.

  • In vitro reconstitution: Attempt stepwise assembly of subcomplexes using purified components to identify specific assembly steps affected by mutations.

Direct Interaction Mapping:

  • Crosslinking mass spectrometry: Use chemical crosslinkers to capture direct interactions between nuoK and other subunits, comparing wild-type and mutant variants.

  • Surface plasmon resonance: Quantitatively measure binding affinities between nuoK and putative interaction partners to detect subtle changes caused by mutations.

  • Bacterial two-hybrid assays: Screen for direct protein-protein interactions affected by nuoK mutations.

Structural Analysis:

  • Comparative structural studies: Obtain structures of both wild-type and mutant complexes to directly visualize assembly differences.

  • Local versus global effects: Use hydrogen-deuterium exchange mass spectrometry to distinguish between localized structural perturbations and widespread conformational changes.

  • Molecular dynamics simulations: Predict how mutations affect interaction energies and dynamic properties at subunit interfaces.

Experimental Decision Tree:
Begin with blue-native PAGE analysis of membrane extracts from cells expressing wild-type or mutant nuoK to determine if complete complexes form . If assembly defects are observed, use immunoblotting to detect the presence of individual subunits in membrane fractions versus soluble fractions. For mutations that allow partial assembly, characterize the subcomplexes formed using co-immunoprecipitation with antibodies against various subunits. Finally, perform direct binding assays between purified components to identify specific interaction defects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.