Recombinant Anoxybacillus flavithermus UPF0344 protein Aflv_2205 (Aflv_2205)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is produced in Escherichia coli expression systems, followed by affinity chromatography using the His-tag. Critical production parameters include:

Table 2: Production and Quality Control

ParameterDetails
Expression HostE. coli
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) for stability
Storage-20°C/-80°C long-term; 4°C for working aliquots (≤1 week)

Functional and Genomic Context

While functional data for Aflv_2205 is limited, comparative genomic studies of A. flavithermus suggest potential roles in stress adaptation or membrane-associated processes in thermophilic environments . Notably:

  • A. flavithermus strains harbor alkali-tolerant genes (e.g., Na+/H+ antiporters) that stabilize proteins under extreme conditions .

  • The Aflv_2205 gene is distinct from well-characterized thermophilic enzymes like AnoCas9, a CRISPR-associated protein studied for its compact nuclease activity .

Applications and Research Utility

Recombinant Aflv_2205 is primarily used in:

  • Antibody Production: As an antigen for ELISA-based assays .

  • Structural Studies: Investigating transmembrane protein dynamics due to its predicted membrane localization .

  • Thermophilic Mechanism Research: Serving as a model for protein stability in high-temperature environments .

Limitations and Future Directions

Current knowledge gaps include:

  • Functional Pathways: No confirmed metabolic or signaling pathways linked to Aflv_2205 .

  • Interaction Networks: Direct protein-protein interactions remain uncharacterized . Further studies using structural biology (e.g., cryo-EM) and knockout models are needed to elucidate its biological significance.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Aflv_2205; UPF0344 protein Aflv_2205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Target Names
Aflv_2205
Target Protein Sequence
MTHAHITTWVVALILFVVAIALQAKGHEKTKMLHMLLRLFYILIIATGAWILHSMSSFPF LYIVKVIVGLWVIGTMEMILVRTAKGKNTNVLWLQFIVAFVVVLYLGFKLPFGFSFFS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0344 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.