Recombinant Anoxybacillus flavithermus UPF0754 membrane protein Aflv_2299 (Aflv_2299)

What is Anoxybacillus flavithermus UPF0754 membrane protein Aflv_2299?

Anoxybacillus flavithermus UPF0754 membrane protein Aflv_2299 is a membrane-associated protein encoded by the Aflv_2299 gene in the thermophilic bacterium Anoxybacillus flavithermus. This protein belongs to the UPF0754 family of proteins with currently uncharacterized function. The full-length protein consists of 369 amino acids and has been successfully expressed as a recombinant protein with N-terminal His-tag in E. coli expression systems .

Anoxybacillus flavithermus is a facultatively anaerobic bacterium found in super-saturated silica solutions and opaline silica sinter, making its membrane proteins potentially significant in understanding adaptations to extreme environments . The bacterium's genome has been fully sequenced, revealing 2,863 predicted proteins, including membrane proteins that may be involved in silica adaptation and biofilm formation processes .

What expression systems are most effective for producing recombinant Aflv_2299?

The recombinant expression of Aflv_2299 has been successfully achieved in E. coli expression systems with an N-terminal His-tag for purification purposes . When designing expression protocols, several considerations must be addressed:

Recommended Expression Protocol:

• Select an E. coli strain optimized for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3))

• Use a vector containing a His-tag for affinity purification

• Culture conditions should account for the thermophilic origin of the protein:

  • Induction at elevated temperatures (28-30°C) may improve proper folding

  • Extended expression times at lower temperatures may increase yield

  • IPTG concentration should be optimized (typically 0.1-0.5 mM)

The expressed protein can be obtained as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability .

How can researchers effectively solubilize and purify Aflv_2299 while maintaining its native structure?

Purification of membrane proteins like Aflv_2299 presents unique challenges due to their hydrophobic nature. A methodological approach involves:

• Membrane Extraction and Solubilization:

  • Harvest cells and disrupt by sonication or French press

  • Isolate membrane fraction by ultracentrifugation

  • Solubilize membranes with appropriate detergents (typically DDM, LDAO, or C12E8)

  • Maintain buffer pH at 8.0 as indicated in storage conditions

• Affinity Purification:

  • Apply solubilized protein to Ni-NTA or similar affinity column

  • Wash extensively to remove non-specific binding

  • Elute with imidazole gradient

• Concentration Without Detergent Accumulation:

  • Utilize ultrafiltration techniques specifically designed to concentrate membrane proteins without concentrating detergent

  • This addresses a critical challenge in membrane protein research, as excess detergent can interfere with structural and functional studies

• Storage Considerations:

  • Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Add glycerol to a final concentration of 5-50% for cryoprotection

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store at -20°C/-80°C for long-term preservation

What experimental approaches are suitable for studying Aflv_2299 membrane dynamics?

Understanding membrane protein dynamics requires specialized techniques that can capture the behavior of proteins within the lipid bilayer environment:

• High-Speed Atomic Force Microscopy (HS-AFM):

  • This technique has been successfully applied to study membrane protein diffusion and interactions in native-like environments

  • HS-AFM can directly measure in-membrane-plane interaction potentials between membrane proteins

  • Protocol requirements include:

    • Sample preparation on mica supports

    • Use of supported lipid bilayers or reconstituted proteoliposomes

    • Imaging in liquid at controlled temperature (important for thermophilic proteins)

• Fluorescence-Based Approaches:

  • FRAP (Fluorescence Recovery After Photobleaching) can measure diffusion coefficients

  • Single-particle tracking with fluorescently labeled protein

  • FRET to measure protein-protein interactions

• Data Analysis Framework:
  Membrane protein dynamics can be analyzed using the following parameters, as demonstrated in studies of other membrane proteins:

  Parameter	Typical Values	Measurement Method
  Diffusion coefficient	0.01-1 μm²/s	FRAP, SPT, HS-AFM
  Oligomerization state	Monomer-dimer equilibrium	HS-AFM, SEC-MALS
  Interaction energy	-3.5 kᵦT (stable dimer)	Center-to-center distance probability distribution
  Repulsion distance	~80 Å	HS-AFM measurements
  Dissociation distance	~125 Å	Energy landscape modeling

The interaction energy landscape of membrane proteins can be experimentally determined through center-to-center distance probability distribution analysis, revealing crucial features such as repulsion, stable association, and dissociation energies .

How might Aflv_2299 contribute to the thermophilic adaptations of Anoxybacillus flavithermus?

Anoxybacillus flavithermus is a thermophilic bacterium found in geothermal environments including super-saturated silica solutions and opaline silica sinter . The potential role of Aflv_2299 in thermophilic adaptation can be investigated through:

• Comparative Genomics Approach:

  • Compare UPF0754 protein sequences across thermophilic and mesophilic bacteria

  • Identify conserved amino acid substitutions specific to thermophilic variants

  • Analyze amino acid composition for features associated with thermostability:

    • Increased proportion of charged residues

    • Higher Ala/Gly ratio

    • Increased hydrophobic core packing

• Thermal Stability Assessment:

  • Circular dichroism (CD) spectroscopy at increasing temperatures

  • Differential scanning calorimetry (DSC)

  • Thermal shift assays with fluorescent dyes

• Functional Analysis at Various Temperatures:

  • Membrane integrity assays in reconstituted systems

  • Protein-protein interaction studies at elevated temperatures

  • Correlation with Anoxybacillus flavithermus growth conditions (optimum growth temperature of 60-65°C)

The amino acid sequence of Aflv_2299 (MGLFLYLLFMIVVGAFIGGMTNSLAIKMLFRPYRPIYIAGKRLPFTPGLIPKRREELAEQLGRMVVEHLLTAEGLRRKLNDPSFVQDMTSYVQEEVEKWLQSDRTVEQWLKQFGMPDPKQTAETWIETKYKTFMSQYRQRPLHEIIPIDVLHKIDHAIPSIVDRLLLRLRTYIESEQGERQIEHMINEFLQSRGMFGNMLQMFLGNVSLAEKIRPEIVKFLQSEGAKQLLVQLFINEWEK VKEMRIHEVEQIIDQEKIVVWVKRLTASIVQEPLQKPLGALVAPYVRHSLPTLVRFLLQFASERIERWMKQLHLQDIVREEVASFSVERLEEMILTISRREFKMITYLGALLGGIIGLIQGCITFFVQM) reveals multiple hydrophobic regions consistent with transmembrane domains, which may contribute to membrane stability at elevated temperatures.

What is the potential role of Aflv_2299 in silica adaptation and biofilm formation?

Anoxybacillus flavithermus has been found in super-saturated silica solutions and opaline silica sinter, suggesting specialized adaptations for these environments . Genome analysis of A. flavithermus has identified enzymes potentially involved in silica adaptation and biofilm formation . The potential role of Aflv_2299 in these processes can be investigated through:

• Silica Interaction Studies:

  • Analyze protein-silica binding using:

    • Quartz crystal microbalance with dissipation monitoring (QCM-D)

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

  • Examine silica precipitation in the presence and absence of purified Aflv_2299

• Biofilm Formation Analysis:

  • Create knockout/knockdown strains (if genetic tools available)

  • Complementation studies with wild-type and mutant versions

  • Quantitative biofilm formation assays comparing:

    • Wild-type A. flavithermus

    • Strains with altered Aflv_2299 expression

    • Heterologous expression in model organisms

• Structural Assessment in Different Environments:

  • Analyze conformational changes in the presence of silica using:

    • Hydrogen-deuterium exchange mass spectrometry

    • FTIR spectroscopy

    • Circular dichroism spectroscopy

Based on proteomic analysis of A. flavithermus, researchers have confirmed the regulation of biofilm-related proteins and enzymes crucial for synthesizing long-chain polyamines, which are constituents of silica nanospheres . This suggests a possible connection between membrane proteins like Aflv_2299 and the silicification and sinter formation processes.

How can researchers optimize detergent selection for structural and functional studies of Aflv_2299?

Detergent selection is crucial for maintaining membrane protein structure and function during purification and characterization. For Aflv_2299, consider:

• Systematic Detergent Screening:

  Detergent Class	Examples	Advantages	Considerations
  Maltoside	DDM, UDM, DM	Gentle, commonly successful	Larger micelles
  Glucoside	OG, NG	Smaller micelles, good for crystallization	More denaturing
  Neopentyl glycol	LMNG, DMNG	High stability, smaller micelles	Cost
  Zwitterionic	FC-12, LDAO	Effective solubilization	Can be harsh
  Steroid-based	Digitonin, GDN	Very gentle, maintains complexes	Heterogeneity

• Thermal Stability Assays:

  • Perform thermal denaturation assays (e.g., DSF, nanoDSF) with various detergents

  • Compare melting temperatures (Tm) to identify stabilizing conditions

  • For thermophilic proteins like Aflv_2299, test at elevated temperatures relevant to the native environment

• Alternative Solubilization Approaches:

  • Amphipols (e.g., A8-35)

  • SMALPs (styrene-maleic acid lipid particles)

  • Nanodiscs with different lipid compositions

  • Liposome reconstitution

• Concentration Methodology:

  • Implement ultrafiltration techniques specifically designed to concentrate membrane proteins without concentrating detergent

  • Monitor detergent concentration using:

    • Colorimetric assays

    • Refractive index detection

    • Thin-layer chromatography

When establishing purification protocols, researchers should consider that Aflv_2299 has been successfully stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 , suggesting these conditions help maintain protein stability.

What bioinformatic approaches can predict the function of UPF0754 family proteins like Aflv_2299?

The UPF0754 family remains functionally uncharacterized, presenting an opportunity for computational prediction:

• Sequence-Based Analysis:

  • Multiple sequence alignment with known membrane proteins

  • Identification of conserved motifs and functional domains

  • Transmembrane topology prediction using:

    • TMHMM

    • Phobius

    • MEMSAT

• Structural Prediction:

  • Ab initio modeling (e.g., AlphaFold, RoseTTAFold)

  • Threading approaches (e.g., I-TASSER, Phyre2)

  • Molecular dynamics simulations in membrane environments

• Functional Inference:

  • Gene neighborhood analysis in the Anoxybacillus flavithermus genome

  • Co-expression network construction

  • Protein-protein interaction prediction

• Evolutionary Analysis:

  • Phylogenetic profiling across bacteria

  • Analysis of selection pressure on different protein regions

  • Correlation with environmental adaptations

The genome of Anoxybacillus flavithermus strain WK1 contains 2,863 predicted proteins , providing context for understanding the potential functional relationships of Aflv_2299 with other proteins in the organism.

How can researchers experimentally determine the oligomeric state of Aflv_2299 in membrane environments?

Membrane protein oligomerization states are critical to understanding function. For Aflv_2299, consider:

• In vitro Approaches:

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Analytical ultracentrifugation with detergent correction

  • Chemical crosslinking followed by SDS-PAGE or mass spectrometry

  • Blue native PAGE

• Microscopy-Based Methods:

  • High-speed atomic force microscopy (HS-AFM) to directly visualize oligomeric states

  • Single-molecule fluorescence techniques (e.g., step photobleaching)

  • Negative stain electron microscopy for initial characterization

• Energy Landscape Analysis:

  • Center-to-center distance probability distribution to calculate interaction energies

  • Modeling of the in-membrane-plane energy landscape, as demonstrated for other membrane proteins

  • Based on similar membrane protein studies, stable dimers might form with interaction energies around -3.5 kᵦT

Studies of other membrane proteins have shown that c-ring dimers can form with most stable association at approximately 103 Å center-to-center distance and dissociation occurring at around 125 Å . Such analyses can provide valuable insights into the potential oligomeric behavior of Aflv_2299.

What experimental approaches can elucidate the membrane topology of Aflv_2299?

Determining the membrane topology of Aflv_2299 is essential for understanding its function:

• Biochemical Methods:

  • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

  • Protease protection assays

  • Glycosylation mapping using engineered glycosylation sites

• Structural Biology Approaches:

  • Cryo-electron microscopy of reconstituted protein

  • X-ray crystallography (challenging for membrane proteins)

  • Solid-state NMR spectroscopy

• Fluorescence-Based Techniques:

  • FRET-based distance measurements between labeled sites

  • Fluorescence quenching accessibility studies

  • GFP-fusion reporter systems

• Computational Validation:

  • Molecular dynamics simulations to test stability of predicted topologies

  • Hydrophobicity analysis correlated with experimental results

  • Evolutionary conservation mapping onto topology models

Based on the amino acid sequence of Aflv_2299 (MGLFLYLLFMIVVGAFIGGMTNSLAIKMLFRPYRPI...) , hydrophobicity analysis suggests multiple potential transmembrane segments, which would need experimental verification.

How can studying Aflv_2299 contribute to understanding extremophile adaptations?

Anoxybacillus flavithermus is a thermophilic bacterium found in extreme environments including super-saturated silica solutions . Studying Aflv_2299 can provide insights into:

• Membrane Adaptations to Extreme Conditions:

  • Compare membrane protein composition and properties between extremophiles and mesophiles

  • Analyze structural features that contribute to thermostability

  • Investigate membrane fluidity regulation mechanisms

• Silicification Processes:

  • Examine protein-mediated silica precipitation

  • Study the formation of opaline silica sinter

  • Investigate biomineralization processes that may resemble those from early Earth

• Evolutionary Perspectives:

  • Analyze gene conservation patterns across thermophilic bacteria

  • Identify convergent adaptations in unrelated thermophiles

  • Trace the evolutionary history of silica adaptation mechanisms

Research on Anoxybacillus flavithermus has been suggested as valuable for studying ancient life through microbial fossils preserved in silica and silica sinters . Membrane proteins like Aflv_2299 may play crucial roles in metabolic adaptation during silicification and sinter formation processes.

What comparative analysis approaches can reveal insights about UPF0754 proteins across different bacterial species?

Comparative analysis of UPF0754 family proteins can reveal evolutionary patterns and functional clues:

• Cross-Species Comparison Framework:

  Species Type	Representative Organisms	Environment	UPF0754 Protein Features
  Thermophilic	Anoxybacillus flavithermus	Geothermal springs, silica sinters	[Features to be analyzed]
  Mesophilic	Bacillus subtilis	Soil, plant surfaces	[Features to be analyzed]
  Psychrophilic	Psychrobacter species	Polar regions, deep sea	[Features to be analyzed]
  Halophilic	Halobacterium species	Salt lakes, brines	[Features to be analyzed]
  Acidophilic	Acidithiobacillus species	Acidic mine drainage	[Features to be analyzed]

• Multi-level Analysis Approach:

  • Primary sequence comparison (conservation, variability)

  • Secondary structure prediction comparison

  • Predicted transmembrane topology comparison

  • Genetic context analysis (neighboring genes)

• Evolutionary Rate Analysis:

  • Calculate dN/dS ratios to identify selection pressures

  • Identify rapidly evolving regions vs. conserved domains

  • Correlate evolutionary patterns with environmental adaptations

Comparative genome analysis suggests extensive gene loss in the Anoxybacillus/Geobacillus branch after its divergence from other bacilli , providing evolutionary context for understanding the retention and potential functional importance of Aflv_2299.

What are the best approaches for reconstituting Aflv_2299 into model membrane systems?

Reconstitution into model membranes is crucial for functional studies:

• Liposome Reconstitution Protocol:

  • Select lipids matching bacterial membrane composition or simplified mixtures

  • For thermophilic proteins, consider:

    • Higher proportion of saturated lipids

    • Addition of branched-chain lipids

    • Testing various lipid:protein ratios (typically 50:1 to 500:1 w/w)

  • Methods include:

    • Detergent removal by dialysis

    • Bio-Beads adsorption

    • Dilution below critical micelle concentration

• Nanodiscs Formation:

  • Select appropriate membrane scaffold protein (MSP)

  • Optimize MSP:lipid:protein ratios

  • Assemble through detergent removal

  • Purify homogeneous populations by size-exclusion chromatography

• Functional Validation Methods:

  • Assess protein orientation using antibody accessibility

  • Measure reconstitution efficiency through protein recovery

  • Verify structure retention using circular dichroism

  • Test functional properties specific to predicted activities

For a membrane protein from a thermophilic organism, reconstitution procedures should include temperature stability testing to ensure the reconstituted system maintains integrity at elevated temperatures matching the native environment of Anoxybacillus flavithermus.

How can researchers overcome solubility challenges when working with recombinant Aflv_2299?

Membrane proteins like Aflv_2299 present significant solubility challenges:

• Expression Optimization:

  • Test fusion partners that enhance solubility (e.g., MBP, SUMO)

  • Explore reduced expression temperatures

  • Evaluate co-expression with chaperones

  • Consider cell-free expression systems

• Solubilization Strategies:

  • Systematic detergent screening beyond conventional options

  • Test detergent mixtures rather than single detergents

  • Evaluate non-detergent solubilization approaches:

    • SMA copolymer extraction

    • Native nanodiscs

    • Amphipathic polymers (amphipols)

• Advanced Concentration Techniques:

  • Implement specialized ultrafiltration approaches to concentrate membrane proteins without concentrating detergent

  • Use tangential flow filtration for larger volumes

  • Consider lyophilization with appropriate cryoprotectants

• Storage Optimization:

  • Test additives beyond glycerol (e.g., trehalose, sucrose)

  • Evaluate protein stability in various buffer systems

  • Determine optimal pH and ionic strength ranges

Based on available information, Aflv_2299 has been successfully maintained as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommendations to add 5-50% glycerol for long-term storage stability .