Recombinant Anthoceros formosae Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-322
Protein Length
Full Length of Mature Protein
Species
Anthoceros formosae (Hornwort)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAVVKIPYDTQVKQV LANGKKGALNVGAVLILPEGFELAPSNRVPPEMKEKIGNLYFQSYRPDKKNILVVGPVPG KKYSEIIFPILAPNPATNKDAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASTTGIIK KVLRKEKGGYEIIIDNTLDGRQVIDIVPPGPELIISEGESIKVDQPLTNNPNVGGFGQGD AEIVLQDVLRVQGLLLFFASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Anthoceros formosae Apocytochrome f and what is its significance in plant evolutionary studies?

Apocytochrome f (petA) is a protein encoded by the chloroplast genome in Anthoceros formosae (hornwort), a critical species for understanding early land plant evolution. The mature protein (amino acids 38-322) functions as part of the cytochrome b6f complex in the photosynthetic electron transport chain after proper processing and heme attachment . Notably, Anthoceros formosae (sometimes referred to as Anthoceros angustus in updated taxonomy) represents a crucial evolutionary position in plant phylogeny, with molecular features suggesting a possible sister relationship between hornworts and tracheophytes (vascular plants) .

The significance of studying this protein extends beyond basic biochemistry, as the petA gene in hornworts provides crucial insights into molecular evolution. The petA gene in A. formosae exhibits unusual characteristics, including an ACG initiation codon that gets converted to the standard AUG by RNA editing, representing an important evolutionary adaptation .

How does the chloroplast genome of Anthoceros formosae compare to other land plants, particularly with respect to the petA gene?

The chloroplast genome of Anthoceros formosae is 161,162 bp in length, making it the largest reported among land plant chloroplasts. It contains 76 protein-coding genes, 32 tRNA genes, 4 rRNA genes, and 10 open reading frames (ORFs) . The genome is divided into two regions by a pair of inverted repeat regions (IR) of 15,744 bp each, with large and small single copy regions of 107,503 and 22,171 bp, respectively .

A key distinction in the Anthoceros formosae chloroplast genome compared to other land plants is the extensive RNA editing occurring in its transcripts. The petA gene specifically contains an unusual ACG initiation codon that is converted to the standard AUG start codon through C-to-U RNA editing, allowing for proper translation . This represents one of the 507 C→U and 432 U→C RNA editing events identified across the Anthoceros chloroplast transcriptome, highlighting the complexity of gene expression regulation in this species .

What are the optimal conditions for expression and purification of recombinant Anthoceros formosae Apocytochrome f?

Based on established protocols, recombinant Anthoceros formosae Apocytochrome f (petA) protein is optimally expressed in Escherichia coli bacterial systems . The recombinant construct typically includes an N-terminal His tag to facilitate purification using affinity chromatography . The expressed protein corresponds to amino acids 38-322 of the mature protein sequence, which excludes the transit peptide region .

For optimal purification results, researchers should:

  • Express the His-tagged recombinant protein in E. coli

  • Purify using nickel or cobalt affinity chromatography

  • Verify protein identity and purity using SDS-PAGE (>90% purity is achievable)

  • Store the purified protein as a lyophilized powder

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

Researchers should avoid repeated freeze-thaw cycles as these can diminish protein activity. For working stocks, aliquots can be stored at 4°C for up to one week .

What methods are available for verifying the structure and function of recombinant Apocytochrome f?

Verification of recombinant Apocytochrome f structure and function requires multiple complementary approaches:

  • Structural verification:

    • SDS-PAGE to confirm molecular weight and purity (>90%)

    • Mass spectrometry to verify the complete amino acid sequence

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Limited proteolysis combined with mass spectrometry to evaluate proper folding

  • Functional verification:

    • Spectroscopic analysis to assess heme binding capabilities

    • Cytochrome c reduction assays to confirm electron transfer functionality

    • Reconstitution experiments with other components of the electron transport chain

When interpreting results, researchers should consider that the recombinant protein may differ from the native form due to the absence of post-translational modifications that occur in vivo, particularly since heme attachment is a critical aspect of cytochrome f maturation .

How does RNA editing impact the expression and function of petA in Anthoceros formosae?

RNA editing plays a crucial role in petA expression in Anthoceros formosae, with significant implications for protein function. The chloroplast genome of A. formosae undergoes extensive RNA editing, with 507 C→U and 432 U→C conversions identified across transcripts of 68 genes and eight ORFs . Specifically for petA, RNA editing converts the unusual initiation codon ACG into the standard AUG start codon through C→U editing .

This RNA editing pattern in hornworts is particularly significant as U→C editing (reverse editing) represents a potential molecular synapomorphy of a hornwort-tracheophyte clade, suggesting evolutionary importance . The presence of both C→U and U→C editing in hornworts like A. formosae creates a unique experimental system for studying RNA editing mechanisms.

Methodologically, researchers investigating RNA editing in petA should:

  • Isolate both genomic DNA and RNA from hornwort tissue

  • Amplify and sequence the petA gene and its transcript

  • Perform comparative analysis to identify all editing sites

  • Use site-directed mutagenesis to assess the functional significance of specific editing events

  • Analyze the role of nuclear-encoded factors (particularly PPR proteins) in recognizing and editing petA transcripts

What is the relationship between protein processing and heme attachment in Apocytochrome f maturation?

The maturation of Apocytochrome f involves a complex interplay between protein processing and heme attachment. Research on cytochrome f (though in Chlamydomonas rather than Anthoceros) has shown that:

  • Biosynthesis requires both processing of the precursor protein and covalent ligation of a c-heme upon membrane insertion

  • The alpha-amino group of Tyr1, generated upon cleavage of the signal sequence, serves as one axial ligand of the c-heme

  • Heme binding is not a prerequisite for cytochrome f processing, as demonstrated through site-directed mutagenesis of cysteinyl residues responsible for covalent ligation of the c-heme

  • Pre-apocytochrome f can adopt a suitable conformation for the cysteinyl residues to be substrates of the heme lyase

  • Pre-holocytochrome f can fold in an assembly-competent conformation

For researchers studying this process in Anthoceros formosae, comparative approaches with other model systems like Chlamydomonas would be valuable. Methodologically, this would involve:

  • Creating constructs with mutations at key residues involved in processing and heme attachment

  • Transforming chloroplasts with these constructs

  • Analyzing the accumulation of precursor and mature forms

  • Assessing heme attachment through spectroscopic methods

  • Evaluating the assembly into functional cytochrome b6f complexes

How can recombinant Anthoceros formosae Apocytochrome f be utilized to investigate chloroplast evolution in early land plants?

Recombinant Anthoceros formosae Apocytochrome f represents a valuable tool for investigating chloroplast evolution in early land plants. Hornworts occupy a critical phylogenetic position, with recent studies suggesting a possible sister relationship to tracheophytes . Several research approaches using recombinant petA can yield insights into evolutionary processes:

  • Comparative structural analysis:

    • Express recombinant petA from multiple species across the plant evolutionary tree

    • Perform detailed structural comparisons to identify conserved and divergent regions

    • Map evolutionary changes onto functional domains to assess selective pressures

  • Functional complementation studies:

    • Test the ability of A. formosae petA to complement mutations in the petA genes of other species

    • Assess whether hornwort petA can functionally integrate into the electron transport chains of diverse plant species

    • Evaluate the evolutionary conservation of interaction interfaces with other components of the photosynthetic machinery

  • Molecular clock analyses:

    • Use petA sequence data to calibrate molecular clocks for chloroplast evolution

    • Incorporate data on RNA editing patterns to understand the evolution of RNA processing mechanisms

Through these approaches, researchers can gain insights into the tempo and mode of chloroplast evolution, particularly during the critical period of early land plant diversification.

What is the significance of monoplastidy in hornworts like Anthoceros formosae and how does it relate to petA function?

Hornworts like Anthoceros formosae feature a unique cellular organization where each cell contains a single large chloroplast (monoplastidy), in contrast to the multiple chloroplasts found in most other plant cells. This distinctive feature has significant implications for understanding chloroplast biology and evolution.

Research suggests that hornworts have lost certain components of the chloroplast division machinery, specifically lacking FtsZ2 and having lost ARC3, which may be crucial factors in the evolution of monoplastidy . The chloroplast in hornwort cells is always positioned next to the nucleus, and the actin cytoskeleton shows close interaction with the chloroplast, suggesting mechanisms for coordinating plastid with cell division .

For researchers investigating the relationship between monoplastidy and petA function:

  • Experimental approaches should include:

    • Fluorescent tagging of Apocytochrome f to visualize its distribution within the single chloroplast

    • Analysis of petA expression and protein accumulation in relation to cell cycle phases

    • Investigation of potential interactions between petA and components of the cytoskeleton

  • Technical considerations:

    • Utilize confocal or multiphoton microscopy for high-resolution imaging of chloroplast structures

    • Employ hornwort transformation systems to express fluorescently-tagged proteins

    • Consider comparative studies with related bryophytes like Marchantia and Physcomitrium that have multiple chloroplasts per cell

Understanding petA function in the context of monoplastidy could provide insights into how electron transport components are organized and regulated within the unique chloroplast architecture of hornworts.

What experimental approaches can be used to study the evolutionary significance of U-to-C RNA editing in petA of Anthoceros formosae?

The presence of U-to-C RNA editing alongside the more common C-to-U editing in Anthoceros formosae represents a significant evolutionary feature that may be a molecular synapomorphy of a hornwort-tracheophyte clade . Investigating this phenomenon requires specialized experimental approaches:

  • Comprehensive editome analysis:

    • Perform deep sequencing of both genomic DNA and RNA from A. formosae

    • Map all editing sites in petA and other transcripts

    • Compare editing patterns across multiple hornwort species and outgroups

  • Identification of editing factors:

    • The nuclear genome of A. formosae contains >1400 genes for pentatricopeptide repeat (PPR) proteins with variable C-terminal DYW domains, which are likely RNA editing factors

    • Use bioinformatic approaches to identify PPR proteins that may target petA based on the PPR-RNA binding code

    • Focus particularly on PPR proteins with variant DYW domains that might be involved in U-to-C editing rather than the more common C-to-U editing

  • Functional validation:

    • Express candidate editing factors in heterologous systems

    • Develop in vitro editing assays with synthesized petA RNA targets

    • Use CRISPR-based approaches to knock out or modify specific PPR proteins

    • Analyze changes in editing patterns and their effects on petA expression and function

These experimental approaches would provide valuable insights into the mechanisms and evolutionary significance of the unique RNA editing patterns in hornwort chloroplasts, potentially clarifying the phylogenetic relationship between hornworts and tracheophytes.

What specialized techniques are required for working with recombinant Anthoceros formosae Apocytochrome f in functional studies?

Working with recombinant Anthoceros formosae Apocytochrome f for functional studies requires specialized techniques that account for its unique properties and functional requirements:

  • Proper reconstitution protocol:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for stability during storage

    • Avoid repeated freeze-thaw cycles that can destabilize the protein structure

  • Heme incorporation:

    • For functional studies, the apocytochrome must be converted to holocytochrome through heme incorporation

    • This process can be performed in vitro using purified heme and appropriate buffer conditions

    • Verify successful heme incorporation through spectroscopic analysis

  • Membrane reconstitution:

    • For studies of electron transport function, reconstitution into liposomes or nanodiscs may be necessary

    • The optimal lipid composition should mimic thylakoid membranes

    • Consider incorporating other components of the electron transport chain for comprehensive functional studies

  • Specialized analytical techniques:

    • Use stopped-flow spectroscopy to measure electron transfer kinetics

    • Employ circular dichroism to monitor conformational changes

    • Consider surface plasmon resonance to study protein-protein interactions

These methodological considerations are essential for maintaining the functional integrity of the recombinant protein during experimental procedures.

How can researchers effectively analyze RNA editing patterns in petA transcripts from Anthoceros formosae?

Analysis of RNA editing patterns in petA transcripts requires specialized methodologies to accurately identify and characterize editing events:

  • Sample preparation:

    • Isolate high-quality total RNA using methods that preserve RNA integrity

    • Prepare parallel genomic DNA samples from the same tissue

    • Consider developmental stage-specific sampling, as editing patterns may vary

  • Sequencing approaches:

    • Perform direct sequencing of RT-PCR products for initial identification of editing sites

    • Use high-throughput sequencing for comprehensive analysis of editing patterns

    • Consider targeted approaches like amplicon sequencing for deep coverage of petA

  • Bioinformatic analysis pipeline:

    • Align RNA-seq reads to the reference genomic sequence

    • Identify positions with consistent differences between genomic and transcript sequences

    • Filter for C-to-U and U-to-C conversions

    • Calculate editing efficiency at each site

  • Validation and quantification:

    • Use poisoned primer extension or similar techniques to quantify editing efficiency at specific sites

    • Consider single-molecule sequencing to analyze editing patterns in individual transcript molecules

This comprehensive approach enables researchers to accurately characterize the complex RNA editing landscape in petA transcripts from Anthoceros formosae, revealing its evolutionary and functional significance .

What are the most promising future research directions for investigating Anthoceros formosae Apocytochrome f?

Future research on Anthoceros formosae Apocytochrome f (petA) holds significant promise in several key areas:

  • Establishing hornworts as model systems:

    • Development of improved transformation protocols for Anthoceros species

    • Creation of mutant collections targeting petA and related genes

    • Integration of hornwort research with studies on other model bryophytes

  • Investigating RNA editing mechanisms:

    • Identification of specific editing factors for petA transcripts

    • Characterization of the molecular machinery responsible for U-to-C editing

    • Evolutionary analysis of editing patterns across land plant lineages

  • Exploring chloroplast evolution:

    • Comparative analysis of cytochrome f structure and function across diverse plant lineages

    • Investigation of the relationship between monoplastidy and electron transport efficiency

    • Modeling of ancient photosynthetic systems based on evolutionary analyses

  • Applications in synthetic biology:

    • Engineering of optimized electron transport components based on insights from hornwort systems

    • Development of RNA editing tools inspired by hornwort editing mechanisms

    • Creation of minimal chloroplast systems incorporating hornwort-derived components

These research directions would not only advance our understanding of hornwort biology but also provide broader insights into photosynthesis evolution, RNA editing mechanisms, and potential biotechnological applications.

How does current research on Anthoceros formosae Apocytochrome f contribute to our understanding of land plant evolution?

Current research on Anthoceros formosae Apocytochrome f contributes significantly to our understanding of land plant evolution in several ways:

  • Phylogenetic insights:

    • Molecular features of hornworts, including distinctive RNA editing patterns in genes like petA, provide evidence for a potential hornwort-tracheophyte clade

    • The unusual initiation codon in petA and its correction through RNA editing represents an evolutionary adaptation that may inform our understanding of chloroplast genome evolution

  • Evolutionary model systems:

    • Hornworts like A. formosae provide a "natural laboratory" for studying the evolution of chloroplast features

    • The loss of specific components of the chloroplast division machinery (FtsZ2, ARC3) in hornworts offers insights into the evolution of organellar division systems

  • Molecular synapomorphies:

    • The presence of both C-to-U and U-to-C RNA editing in hornwort chloroplasts may represent a molecular synapomorphy (shared derived trait) of hornworts and tracheophytes

    • This characteristic provides a molecular marker for resolving deep phylogenetic relationships among early land plants

  • Organellar genome evolution:

    • The hornwort chloroplast genome, at 161,162 bp, is the largest reported among land plants, providing insights into genome expansion patterns during evolution

    • Comparative analysis of gene content and arrangement between hornworts and other plant lineages reveals patterns of conservation and innovation in chloroplast genome architecture

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.