Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF)

Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF), is a protein component of the ATP synthase complex found in the chloroplasts of Anthoceros formosae, a species of hornwort . ATP synthase is an essential enzyme that produces adenosine triphosphate (ATP), the primary energy currency of cells, by utilizing the proton motive force generated during photosynthesis . The atpF subunit is a specific part of this complex, playing a role in its structure and function . Recombinant atpF is produced using genetic engineering techniques, where the gene encoding the atpF subunit is expressed in a host organism, such as E. coli, to generate a purified protein product .

Production and Purification

Recombinant atpF is produced through the following steps:

  1. Gene Cloning: The gene encoding the atpF subunit from Anthoceros formosae is isolated and cloned into an expression vector .

  2. Expression in Host Organism: The expression vector is transformed into a host organism, typically E. coli, which then produces the atpF protein .

  3. Purification: The recombinant atpF protein is purified from the host cells using various chromatography techniques, such as affinity chromatography, exploiting specific tags (e.g., His-tag) added to the protein .

Research Findings and Significance

Research involving the ATP synthase subunit b, chloroplastic (atpF) focuses on understanding photosynthesis, energy production, and plant metabolism . Some key areas of investigation include:

  • Enhancing Photosynthesis: Overexpression of certain ATP synthase subunits can increase the abundance and activity of the entire complex, leading to higher CO$$_2$$ assimilation rates and improved plant growth .

  • Regulation of ATP/NADPH Ratio: Efficient photosynthesis requires a balance of ATP and NADPH production in chloroplasts. The atpF subunit plays a role in maintaining this balance .

  • Mitochondrial Cooperation: Chloroplasts and mitochondria must cooperate to optimize reductant production and consumption. The ATP synthase complex, including the atpF subunit, is vital in these processes .

Data Table: Properties of Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF)

PropertyDescription
SourceAnthoceros formosae (Hornwort)
Molecular WeightVaries depending on post-translational modifications and tags
Purity>85% (SDS-PAGE)
Expression SystemE. coli or Baculovirus
TagHis-tag (commonly used for purification)
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol for long-term storage .

Future Directions

  • Improving Crop Yield: By manipulating the expression of ATP synthase subunits like atpF, it may be possible to enhance photosynthetic efficiency and increase crop yields .

  • Understanding Regulatory Mechanisms: Further research is needed to elucidate the regulatory mechanisms that control the expression and activity of ATP synthase subunits .

  • Biotechnological Applications: Recombinant atpF can be used in various biotechnological applications, such as in vitro ATP synthesis and structural studies of the ATP synthase complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
atpF
Target Protein Sequence
MRNLIFFVIPFHFWLPAEGFKLNTNLLETNLINLGVVLGLLVYFGKGVLNNLLDKRKQTI LSTIRDAEERYKEATDKLKQAQIRLQQAELKANEIRVNGLSEMEKEKQDLINIADEDSKR LEDSKNATIRFEEQRAIEQVRQQVSRLALERASEVLNNCLNSELHSRMIDYHIGLLKTMG STTE
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic context of atpF in Anthoceros formosae chloroplasts?

The atpF gene encoding ATP synthase subunit b is found within the chloroplast genome of Anthoceros formosae. This circular double-stranded DNA is 161,162 bp in length, making it the largest genome ever reported among land plant chloroplasts. The complete chloroplast genome contains 76 protein-coding genes (including atpF), 32 tRNA genes, and 4 rRNA genes, along with 10 open reading frames (ORFs) . The atpF gene is part of the conserved gene set found in chloroplast genomes across land plants, contributing to the ATP synthase complex essential for photosynthetic energy production.

How does RNA editing affect atpF transcripts in Anthoceros formosae?

While search results don't specifically address atpF RNA editing, A. formosae demonstrates extensive RNA editing in its chloroplast transcripts, with 507 C→U and 432 U→C conversions identified across 68 genes and eight ORFs . Some genes show conversion of unusual initiation codons (ACG) to the standard AUG via C→U editing, and numerous nonsense codons are converted to sense codons through U→C conversions . Researchers working with atpF should verify whether similar editing events occur in this gene, as this could significantly impact protein expression and function in recombinant systems.

What are the optimal expression systems for producing recombinant Anthoceros formosae atpF?

Based on transformation protocols developed for related hornwort species, several expression systems can be considered. For heterologous expression, bacterial systems like E. coli may be suitable for basic structural studies, while eukaryotic systems might better accommodate post-translational modifications. For homologous expression, Agrobacterium-mediated transformation of Anthoceros species has been successfully established . When using the Agrobacterium-mediated approach in Anthoceros agrestis (a related species), controlling pH during co-cultivation is crucial, as values increase from an initial 5.8 to about 7-8 during the process, which may affect transformation efficiency .

How do promoter choices affect recombinant atpF expression in hornwort systems?

Promoter selection significantly impacts transformation efficiency and expression levels. Comparative studies with Anthoceros agrestis demonstrated that while both the CaMV 35S promoter and the endogenous AaEf1a (A. agrestis Elongation Factor 1a) promoter can drive gene expression, plants transformed with the AaEf1a promoter showed better growth compared to those with the CaMV 35S promoter when expressing a selection marker . This suggests that for optimal expression of recombinant atpF, endogenous hornwort promoters may provide more physiologically appropriate expression levels than viral promoters.

What are the most effective methods for purifying recombinant atpF protein from expression systems?

For purification of recombinant atpF, a multi-step approach is recommended:

  • Initial extraction: Homogenize transformed tissue in buffer containing appropriate detergents (typically 0.5-1% Triton X-100) to solubilize membrane-associated proteins.

  • Clarification: Remove cellular debris through centrifugation (10,000-20,000 × g).

  • Affinity chromatography: If expressed with affinity tags (His-tag, FLAG-tag), use corresponding resins.

  • Size exclusion chromatography: Separate purified protein from aggregates and contaminants.

For tissue homogenization protocols, researchers working with Anthoceros tissue have successfully used liquid nitrogen grinding followed by resuspension in buffer containing protease inhibitors . Western blotting confirms protein expression using antibodies against the protein or associated tags.

How can researchers verify the structural integrity of recombinant atpF?

Verifying structural integrity involves multiple approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Limited proteolysis to evaluate proper folding

  • Size exclusion chromatography to determine oligomeric state

  • Functional assays to confirm ATP synthase activity when reconstituted with other subunits

When analyzing membrane proteins like atpF, proper detergent selection during purification is crucial for maintaining native-like structure. A comparative detergent screen (including DDM, LMNG, and digitonin) is recommended to identify optimal conditions for structural preservation.

How can researchers assess if recombinant atpF properly assembles into functional ATP synthase complexes?

Assessment of proper assembly requires:

  • Co-immunoprecipitation experiments with other ATP synthase subunits

  • Blue native PAGE to visualize intact complexes

  • ATP synthesis activity assays using reconstituted proteoliposomes

  • Proton pumping assays using pH-sensitive fluorescent dyes

For hornwort-specific applications, researchers should consider that assembly might be affected by species-specific factors. When expressing in heterologous systems, co-expression with other Anthoceros ATP synthase subunits may improve complex assembly and stability.

What techniques can be used to study the interaction between atpF and other ATP synthase subunits?

Multiple complementary approaches are recommended:

  • Yeast two-hybrid screening to identify direct protein-protein interactions

  • Bimolecular fluorescence complementation (BiFC) for in vivo interaction verification

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for binding kinetics

  • Cryo-electron microscopy for structural analysis of the assembled complex

When expressing fluorescent fusion proteins in Anthoceros tissue, researchers have successfully used confocal microscopy with a Leica SP8X spectral fluorescence confocal microscope , suggesting similar approaches could be applied to visualization of atpF interactions.

How does Anthoceros formosae atpF differ from other bryophyte and land plant homologs?

Evolutionary analysis should consider:

  • Sequence conservation across land plant lineages

  • Bryophyte-specific adaptations in structure and function

  • Hornwort-specific features related to their unique chloroplast biology

The chloroplast genome organization of Anthoceros formosae differs from other bryophytes like Marchantia polymorpha, particularly in the inverted repeat regions and gene arrangements . These genomic differences may reflect in the evolution and function of atpF. Comparative sequence analysis with atpF from Marchantia, vascular plants (Nicotiana, Pinus), and algal representatives would provide evolutionary context for functional studies.

What is the significance of atpF in the context of Anthoceros formosae's unique carbon-concentrating mechanism?

Hornworts like Anthoceros possess pyrenoids and carbon-concentrating mechanisms (CCM) uncommon in other land plants. Research questions to address include:

  • Does atpF play a specialized role in supporting the energetics of the CCM?

  • Are there structural adaptations in hornwort ATP synthase related to CCM?

  • How does ATP production via the chloroplast ATP synthase integrate with carbon fixation efficiency?

Transformation techniques now available for hornworts provide opportunities to investigate these questions through gene manipulation approaches. The stable transformation method developed for A. agrestis, with reported transformation efficiency of 3-23 successful events per experiment , offers a potential pathway to study atpF function through genetic modification.

How does RNA editing affect the expression and function of atpF in Anthoceros formosae?

RNA editing is extensive in Anthoceros chloroplast transcripts. Researchers investigating atpF should:

  • Map all RNA editing sites within the atpF transcript through cDNA sequencing

  • Determine the impact of editing on codon usage and protein sequence

  • Assess whether editing is tissue-specific or developmentally regulated

  • Consider editing requirements when designing recombinant expression strategies

The extensive RNA editing observed in Anthoceros (507 C→U and 432 U→C conversions) suggests that atpF transcripts may undergo significant post-transcriptional modification. When studying recombinant expression, researchers must consider whether to use the genomic sequence or the edited cDNA sequence to ensure proper protein production.

What methods are most effective for studying post-transcriptional regulation of atpF?

Recommended approaches include:

  • RT-PCR and sequencing to identify RNA editing sites

  • RNA immunoprecipitation to identify RNA-binding proteins involved in regulation

  • Reporter gene assays to study 5' and 3' UTR regulatory elements

  • RNA stability assays to assess transcript longevity

Transcriptome analysis of Anthoceros can reveal whether atpF exhibits circadian regulation similar to other chloroplast genes. In Anthoceros, genes like CAA1 and DET1 show circadian oscillation with peaks in the morning , and similar patterns might exist for photosynthesis-related genes like atpF.

What are the challenges in expressing membrane proteins like atpF in recombinant systems?

Membrane protein expression presents several challenges:

  • Proper membrane insertion and folding

  • Prevention of aggregation during expression

  • Selection of appropriate detergents for extraction and purification

  • Maintaining native-like lipid environment

For hornwort-specific expression, the Agrobacterium-mediated transformation protocol developed for A. agrestis provides a framework, with transformation efficiency influenced by factors such as buffer pH, MES concentration (20-40 mM) and Agrobacterium strain (AGL1 or GV3101) .

How can CRISPR-Cas9 gene editing be adapted for studying atpF function in Anthoceros?

Implementing CRISPR-Cas9 in hornworts would require:

  • Design of guide RNAs targeting chloroplast atpF

  • Development of chloroplast transformation protocols

  • Selection strategies for identifying edited plants

  • Phenotypic characterization of edited lines

While current transformation protocols for Anthoceros focus on nuclear genome transformation , adaptation for chloroplast genome editing would provide powerful tools for atpF functional studies. The high regenerative capacity of Anthoceros thallus tissue, which can regenerate an entire plant from small fragments without requiring hormone treatments , provides an advantage for generating and propagating edited lines.

What are the optimal conditions for isolating intact chloroplasts from Anthoceros formosae for ATP synthase studies?

Recommended protocol:

  • Homogenize tissue in isolation buffer (0.33 M sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 1% BSA)

  • Filter through miracloth to remove debris

  • Centrifuge at 1,000 × g for 5 minutes

  • Resuspend pellet and purify chloroplasts via Percoll gradient centrifugation

  • Wash and resuspend in storage buffer

For Anthoceros tissue preparation, researchers have successfully used protocols beginning with grinding in liquid nitrogen, followed by buffer resuspension with protease inhibitors . This approach could be adapted for chloroplast isolation by using appropriate isolation buffers.

What analytical techniques provide the most information about atpF structure-function relationships?

A multi-faceted analytical approach is recommended:

TechniqueInformation ObtainedTechnical Considerations
X-ray crystallographyHigh-resolution structural dataRequires highly purified, crystallizable protein
Cryo-EMStructure of entire ATP synthase complexPreserves native-like state, less protein required
NMR spectroscopyDynamic structural informationLimited by protein size, requires isotope labeling
Hydrogen-deuterium exchange MSConformational dynamics and solvent accessibilityCan identify regulatory sites and binding interfaces
Site-directed mutagenesisFunctional significance of specific residuesRequires recombinant expression system

The successful transformation methods for Anthoceros species provide a foundation for generating modified versions of atpF for structure-function studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.