Recombinant Anthoceros formosae Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
petD
Target Protein Sequence
MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTIFLIGTAVAIWLGIGAALPIDKSLTLGLS
Uniprot No.

Target Background

Function

Recombinant Anthoceros formosae Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), supports cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of Anthoceros formosae petD compare to other species?

Comparative analysis reveals both conservation and divergence across species:

SpeciesLength (aa)Notable Sequence FeaturesUniProt ID
Anthoceros formosae160Contains membrane-spanning domains with characteristic hydrophobic residuesQ85AY5
Chaetosphaeridium globosum160Shows high sequence similarity but has CIFGT instead of VILGT motifQ8M9Z5
Synechococcus sp.160Contains slightly different hydrophobic domainsQ0ICP7

The sequence alignment indicates evolutionary conservation of functional domains while showing species-specific variations, particularly in the membrane-spanning regions .

What are the optimal conditions for expressing recombinant Anthoceros formosae petD protein?

Expression of recombinant A. formosae petD requires careful optimization:

  • Expression System Selection: While E. coli is commonly used for expression of recombinant petD proteins , the hydrophobic nature of this membrane protein presents challenges. Consider:

    • Using strains optimized for membrane proteins (e.g., C41(DE3) or C43(DE3))

    • Testing multiple fusion tags (His-tag typically used at N-terminus)

    • Exploring alternative expression systems for problematic constructs

  • Expression Conditions:

    • Temperature: Lower induction temperatures (16-25°C) often yield better results for membrane proteins

    • Inducer concentration: Typically 0.1-0.5 mM IPTG for T7-based systems

    • Duration: 4-12 hours post-induction, depending on strain and conditions

  • Solubilization and Purification:

    • Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has proven effective

    • Use of detergents: Required for membrane protein extraction and stability

    • Storage: -20°C to -80°C in buffer containing 50% glycerol to prevent freeze-thaw damage

How can researchers effectively analyze the functional activity of recombinant petD protein?

Functional analysis of cytochrome b6-f complex subunit 4 can be approached through several methodologies:

  • Electron Transfer Activity Assay:

    • Similar to methodologies used with native complex, where trypsinolysis of the complex shows that subunit IV degradation correlates with decreased electron transfer activity

    • Measure activity using plastoquinol-plastocyanin oxidoreductase assays

  • Binding Assays:

    • Azido-Q binding experiments can assess functionality as demonstrated in natural complexes

    • The extent of binding correlates with electron transfer capability

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm proper secondary structure

    • Limited proteolysis to compare digestion patterns with native protein

    • Absorption and EPR spectral properties can be evaluated as they typically remain unchanged even when activity is compromised

What RNA editing events affect the petD transcript in Anthoceros formosae, and how should researchers account for them?

RNA editing in A. formosae chloroplast transcripts is extensive and affects the petD gene:

  • Types and Extent of RNA Editing:

    • Both C-to-U and U-to-C conversions occur in A. formosae chloroplast transcripts

    • 507 C→U and 432 U→C conversions have been identified across 68 genes and eight ORFs

    • Specific editing sites in petD should be identified by comparing genomic and cDNA sequences

  • Methodological Approach:

    • Total RNA isolation using modified CTAB method

    • cDNA synthesis for chloroplast transcripts

    • Sequence both genomic DNA and cDNA to identify editing sites

    • Design primers that account for known edit sites when working with cDNA templates

  • Research Implications:

    • RNA editing may affect codon usage and protein sequence

    • When designing expression constructs, researchers must decide whether to use the genomic sequence or the edited cDNA sequence

    • For functional studies, the edited sequence is typically preferred to match the native protein

How do U-to-C RNA editing mechanisms potentially affect research on Anthoceros formosae petD?

U-to-C RNA editing is particularly significant in hornworts like A. formosae:

  • Evolutionary Significance:

    • The emergence of U-to-C RNA editing accompanying C-to-U editing may represent a molecular synapomorphy of a hornwort–tracheophyte clade

    • A. formosae is emerging as a model system for studying U-to-C RNA editing

  • Molecular Mechanisms:

    • U-to-C editing likely involves different mechanisms than C-to-U editing

    • Pentatricopeptide repeat (PPR) proteins with DYW domains may be involved

    • Some evidence suggests variants of the 'classic' DYW domain that may function as editing factors

  • Research Considerations:

    • When expressing recombinant petD, researchers should be aware of potential functional differences between edited and non-edited protein versions

    • Experimental validation of RNA editing sites is necessary before protein expression

    • The potential for differential editing efficiency across tissues may affect interpretation of results

How can researchers effectively use Anthoceros formosae petD for phylogenetic studies?

The petD gene from A. formosae provides valuable data for phylogenetic analyses:

  • Methodological Approach:

    • Multiple sequence alignment of petD amino acid sequences from diverse species

    • Use of appropriate phylogenetic models (e.g., maximum likelihood, Bayesian inference)

    • Integration with other genes for robust analysis (e.g., combinatorial analysis with other chloroplast genes)

  • Evolutionary Context:

    • A. formosae represents hornworts, which are crucial for understanding early land plant phylogeny

    • The chloroplast genome of A. formosae shows unique features compared to other land plants, including a larger inverted repeat region containing additional genes

    • Comparative analysis with liverwort Marchantia polymorpha and other land plants provides insights into chloroplast evolution

  • Research Applications:

    • Investigation of land plant evolution and diversification

    • Analysis of plastid gene evolution and rearrangements

    • Understanding the unique aspects of hornwort biology in an evolutionary context

What technical challenges arise when comparing recombinant petD proteins from different species?

Comparative studies involving petD proteins from multiple species present several technical challenges:

  • Expression System Optimization:

    • Different species' proteins may require different optimization strategies

    • Codon optimization may be necessary depending on the expression system

    • Standardization of expression conditions is essential for valid comparisons

  • Structural Differences:

    • Species-specific variations in hydrophobic domains may affect solubility and folding

    • Subtle differences in protein structure may influence functional assays

    • Post-translational modifications may differ between natural and recombinant proteins

  • Functional Comparison Methodology:

    • Development of standardized assays that work equally well for proteins from different species

    • Accounting for species-specific cofactors or environmental conditions

    • Ensuring that tagged versions maintain comparable activity to natural proteins

How can researchers investigate the interaction between petD and other components of the cytochrome b6-f complex?

Advanced studies of protein-protein interactions within the cytochrome b6-f complex require sophisticated methodologies:

  • Co-expression and Co-purification Strategies:

    • Co-expression of multiple subunits to facilitate complex assembly

    • Tandem affinity purification using differentially tagged subunits

    • Analysis of complex integrity using native PAGE or gel filtration

  • Interaction Analysis Techniques:

    • Cross-linking studies to identify interaction interfaces

    • Surface plasmon resonance to determine binding kinetics

    • Yeast two-hybrid or split-GFP assays for specific interaction mapping

  • Functional Implications:

    • Trypsinolysis experiments have shown that digestion of subunit IV correlates with decreased electron transfer activity and proton translocation capability

    • Investigation of specific residues involved in these functions can be conducted through site-directed mutagenesis

    • Structural analysis suggests that subunit IV may protrude from the lumen side of the membrane

What approaches can be used to study the impact of RNA editing on petD protein structure and function?

This represents an advanced research question requiring sophisticated methodologies:

  • Comparative Expression and Analysis:

    • Express both edited and non-edited versions of the protein

    • Perform detailed structural comparisons using circular dichroism, limited proteolysis, or crystallography

    • Compare functional properties using electron transfer and binding assays

  • Site-Specific Analysis of Edited Positions:

    • Use site-directed mutagenesis to systematically investigate the impact of each editing event

    • Incorporate unnatural amino acids at edited positions to probe function

    • Develop in vitro RNA editing systems to study the process dynamically

  • Integration with PPR Protein Research:

    • Investigate the role of PPR proteins in recognizing edit sites

    • The hornwort A. agrestis (closely related to A. formosae) has >1400 genes for PPR proteins with variable C-terminal DYW domains

    • Explore RNA-binding specificity of PPR proteins to petD transcripts

How can researchers overcome solubility issues when working with recombinant Anthoceros formosae petD?

As a membrane protein, petD presents significant solubility challenges:

  • Optimization Strategies:

    • Test multiple detergents (DDM, LDAO, FC-12) at varying concentrations

    • Utilize solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Explore amphipol or nanodisc technologies for maintaining native-like environments

  • Expression Condition Modifications:

    • Reduce expression temperature to 16°C or lower

    • Decrease inducer concentration to promote slower, more efficient folding

    • Consider auto-induction media to provide gradual protein expression

  • Purification Approaches:

    • Use two-phase extraction methods for initial separation

    • Implement gentle purification protocols with minimal temperature changes

    • Consider on-column refolding for proteins recovered from inclusion bodies

What are the best approaches for validating recombinant Anthoceros formosae petD functionality compared to the native protein?

Ensuring recombinant protein functionality requires careful validation:

  • Structural Validation:

    • SDS-PAGE and Western blotting for size and immunoreactivity

    • Mass spectrometry to confirm sequence integrity

    • Secondary structure analysis via circular dichroism compared to predictions

  • Functional Assays:

    • Electron transfer activity measurements compared to the native complex

    • Binding studies with known interaction partners

    • Sensitivity to trypsinolysis, which should correlate with activity loss as in the native protein

  • Integration into Partial or Complete Complexes:

    • Reconstitution experiments with other purified components

    • Complementation studies in model systems

    • Analysis of proton translocation capability, which is compromised when subunit IV is degraded

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.