Recombinant Anthoceros formosae Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant cytochrome b6 is synthesized using heterologous expression systems:

  • Cloning: Full-length petB cDNA (1–222 aa) is cloned into plasmids under T7/lac promoters .

  • Expression: Induced in E. coli BL21(DE3) with IPTG, followed by solubilization using detergents like DDM .

  • Purification: Ni-NTA affinity chromatography yields >85% pure protein .

Role in Cytochrome b6/f Complex Assembly

  • PetB integrates into thylakoid membranes via the ALB3 insertase in a co-translational manner .

  • Key Interactions:

    • Binds CSP41 (chloroplast stem-loop-binding protein) for mRNA stabilization .

    • Requires low-molecular-weight subunits (PetG, PetN) for complex stability .

Electron Transport Mechanism

  • Facilitates electron transfer between photosystems II and I via plastoquinol oxidation .

  • Participates in cyclic electron flow around PSI, critical for ATP synthesis under stress .

Research Applications

  • Structural Studies: Used in crystallography to resolve membrane protein dynamics .

  • Mutagenesis: Knockout lines (ΔpetB) reveal its necessity for photoautotrophic growth in plants .

  • Biotechnology: Engineered variants aid in optimizing photosynthetic efficiency in crops .

Comparative Analysis

Table 2: PetB Homologs Across Species

SpeciesPetB Length (aa)Key Features
Anthoceros formosae215RNA-edited initiation codon (ACG→AUG)
Nicotiana tabacum222Requires PrfB3 for RNA stability
Chlamydomonas reinhardtii214Lacks introns in petB

Challenges and Future Directions

  • Stability Issues: Recombinant PetB requires glycerol (50%) for long-term storage .

  • Functional Redundancy: Partial functional overlap with bacterial homologs warrants further study .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVASGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPLVGSSLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVLMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of petB in Anthoceros formosae?

The petB gene in Anthoceros formosae is located within the chloroplast genome, which spans 161,162 base pairs and represents the largest genome reported among land plant chloroplasts. The genome is divided into two regions by a pair of inverted repeat regions (IR) of 15,744 bp each, with large and small single copy regions of 107,503 and 22,171 bp, respectively. The petB gene encodes the cytochrome b6 subunit of the cytochrome b6f complex, a crucial component of the photosynthetic electron transport chain .

How does RNA editing affect the petB transcript in Anthoceros formosae?

RNA editing in Anthoceros formosae chloroplasts is exceptionally extensive, affecting the petB transcript through both C-to-U and U-to-C conversions. This editing process substantially alters the amino acid composition of the resulting protein, primarily increasing the hydrophobicity of the cytochrome b6 protein, which is critical for its proper folding and function within the thylakoid membrane .

What introns are present in the petB gene of Anthoceros formosae?

The petB gene in Anthoceros formosae contains introns that undergo splicing during post-transcriptional processing. Specifically, petB-i1 has been identified in comparative genomic studies of land plants. This intron is conserved across diverse plant lineages, including bryophytes like A. formosae and Marchantia polymorpha, indicating its evolutionary importance .

The presence and conservation of this intron provide valuable insights into the evolutionary history of land plants and the structural organization of chloroplast genes. In contrast to A. formosae, some cyanobacteria lack introns in their petB gene, as demonstrated in Synechocystis sp. PCC 6803, where aminoterminal sequencing of the isolated protein confirms the absence of introns after the first amino acids .

What techniques are recommended for cloning and expressing recombinant A. formosae cytochrome b6?

For successful cloning and expression of recombinant A. formosae cytochrome b6, researchers should implement a comprehensive protocol that accounts for the unique characteristics of this gene:

  • Genomic DNA Isolation: Extract total DNA from A. formosae tissue using modified CTAB (cetyltrimethylammonium bromide) methods, which have proven effective for hornwort samples. This approach successfully yielded high-quality DNA suitable for downstream applications in previous studies of A. formosae .

  • PCR Amplification: Design primers based on the published genomic sequence, positioning them 20-50 nucleotides upstream and downstream of the coding region to ensure amplification of the entire coding sequence. This strategy was successfully employed in the sequencing of the A. formosae chloroplast genome .

  • Expression Vector Selection: Given the extensive RNA editing in native A. formosae, researchers should consider using a codon-optimized synthetic gene based on the edited cDNA sequence rather than the genomic sequence to ensure correct amino acid incorporation in heterologous expression systems.

  • Expression Considerations: For functional expression, consider the Rieske Fe-S protein's role in cytochrome b6f complex assembly, as its absence can destabilize other components including cytochrome b6, as observed in Lemna perpusilla mutants .

How can researchers verify proper RNA editing of petB transcripts in experimental systems?

Verification of RNA editing in petB transcripts requires a methodical approach comparing genomic DNA with transcripts:

  • Parallel Sequencing: Isolate total RNA from A. formosae using modified CTAB methods. Synthesize cDNA for chloroplast transcripts and perform parallel sequencing of both genomic DNA and cDNA of the petB region. This approach has successfully identified numerous editing sites in previous studies .

  • Editing Site Confirmation: Compare the sequences of genomic DNA and cDNA to identify potential RNA editing sites. For A. formosae, expect to find both C-to-U and U-to-C conversions, with editing efficiency typically approaching 100% at each site .

  • Quantitative Analysis: To assess editing efficiency, employ high-throughput sequencing methods that provide quantitative data on the proportion of edited versus unedited transcripts at each site. This is particularly important when studying factors affecting editing efficiency or when comparing different experimental conditions.

  • Functional Validation: Confirm the functional significance of RNA editing through protein structure prediction or activity assays comparing native (edited) and recombinant (potentially unedited) proteins. Previous studies have demonstrated that RNA editing is required to form functional protein structures in A. formosae .

What protocols enable accurate assessment of recombinant cytochrome b6 protein quality and function?

Assessing the quality and function of recombinant A. formosae cytochrome b6 requires multiple analytical approaches:

  • Spectroscopic Analysis: Validate proper heme incorporation and folding through UV-visible spectroscopy, examining characteristic absorption peaks of cytochrome b6. Properly folded cytochrome b6 exhibits specific spectral properties reflecting its heme coordination state.

  • Redox Potential Measurements: Determine the redox potential of purified recombinant cytochrome b6 using potentiometric titrations. Compare these values with native protein to confirm functional properties.

  • Complex Assembly Assessment: Evaluate the ability of recombinant cytochrome b6 to assemble with other components of the cytochrome b6f complex, particularly considering the critical role of the Rieske Fe-S protein in complex assembly observed in other species .

  • Functional Reconstitution: For definitive functional validation, perform reconstitution experiments where recombinant cytochrome b6 is incorporated into liposomes or membrane systems capable of supporting electron transport. Measure electron transfer rates to confirm functionality.

  • Structural Integrity Verification: Employ circular dichroism spectroscopy and thermal stability assays to confirm proper protein folding and stability, especially considering that RNA editing significantly increases hydrophobic amino acid content, which is crucial for proper structural conformation .

How does the extensive RNA editing in A. formosae petB compare with other hornworts and land plants?

RNA editing in A. formosae petB represents part of an extraordinarily extensive editing system that far exceeds that observed in most land plants:

SpeciesOrganelleC-to-U EditsU-to-C EditsTotal EditsReference
Anthoceros formosaeChloroplast509433942
Arabidopsis thalianaChloroplast~300~30
Arabidopsis thalianaMitochondria4560456
LeiosporocerosPlastomeAll edit sitesNoneSignificantly fewer than Anthoceros
LeiosporocerosMitogenome88/108 sites20/108 sites108
MaizeChloroplast25025
TobaccoChloroplast31031
Black PineChloroplast26026

The comparative analysis reveals that A. formosae exhibits an unprecedented level of RNA editing in its chloroplast, with a frequency (942 sites in 161 kb) exceeding even that of Arabidopsis mitochondria (456 sites in 367 kb). Most remarkably, A. formosae demonstrates extensive U-to-C editing, which is extremely rare in other land plants .

Different hornwort lineages show varying levels of RNA editing, suggesting fluctuation during hornwort diversification. For instance, Leiosporoceros shows significantly less editing than Anthoceros, with approximately 88% fewer editing events in its plastome .

What mechanisms govern the site-specific RNA editing of petB transcripts in A. formosae?

RNA editing in A. formosae involves complex molecular machinery that demonstrates remarkable site specificity:

What evolutionary insights can be gained from studying A. formosae cytochrome b6 structure and function?

Studying A. formosae cytochrome b6 offers valuable evolutionary insights:

  • Evolutionary Position: As hornworts represent an early diverging lineage of land plants, their molecular characteristics provide a window into the ancestral state of land plant chloroplasts. The petB gene structure and its extensive RNA editing pattern in A. formosae represent an intermediate evolutionary state between algal ancestors and more derived land plants .

  • RNA Editing Evolution: The extensive RNA editing in A. formosae, particularly the high frequency of U-to-C conversions, suggests that this type of editing may have been more common in early land plants and was subsequently lost in many lineages. The varying levels of RNA editing across hornwort species indicate that editing frequencies have fluctuated during hornwort diversification .

  • Intron Conservation: The presence of introns in the petB gene (specifically petB-i1) across diverse plant lineages provides insights into the evolutionary history of gene structure. Comparative analysis of intron presence/absence patterns can help resolve phylogenetic relationships and evolutionary trajectories .

  • Functional Constraints: The consistent pattern of RNA editing increasing hydrophobic amino acid content suggests strong functional constraints on protein structure that have been maintained through alternative mechanisms (genomic encoding versus RNA editing) across evolutionary time .

How can recombinant A. formosae cytochrome b6 serve as a model system for studying RNA editing?

Recombinant A. formosae cytochrome b6 offers unique advantages as a model system for RNA editing research:

  • Comprehensive Editing Landscape: With its extensive and diverse RNA editing sites (both C-to-U and U-to-C), A. formosae petB provides a robust system for studying the biochemical mechanisms and molecular recognition elements that determine editing specificity .

  • Functional Consequences Assessment: The ability to express both edited (cDNA-derived) and unedited (genomic DNA-derived) versions of cytochrome b6 allows direct experimental assessment of how RNA editing affects protein structure, stability, and function. This comparison can reveal which editing events are critical for protein function versus those that may be neutral .

  • Evolutionary Research Platform: The intermediate evolutionary position of hornworts makes A. formosae cytochrome b6 valuable for understanding the evolution of RNA editing in land plants. By comparing it with homologs from other plant lineages, researchers can track changes in editing patterns through evolutionary time .

  • Editing Machinery Investigation: Developing recombinant expression systems for A. formosae cytochrome b6 necessitates understanding the trans-acting factors and cis-elements required for proper RNA editing, potentially leading to the identification of novel components of the editing machinery .

What insights about photosynthetic electron transport can be gained from studying A. formosae cytochrome b6?

Studying A. formosae cytochrome b6 provides several valuable insights into photosynthetic electron transport:

  • Structural Requirements: The extensive RNA editing in A. formosae cytochrome b6 transcripts, primarily increasing hydrophobicity, highlights the critical structural requirements for proper function within the thylakoid membrane. This information enhances our understanding of the structural determinants of electron transport efficiency .

  • Evolutionary Adaptation: Comparing the functional properties of A. formosae cytochrome b6 with those from other evolutionary lineages can reveal how photosynthetic electron transport has adapted across diverse environments during land plant evolution.

  • Assembly Process Understanding: Research on cytochrome b6f complex assembly in other species has demonstrated the importance of coordinated expression of nuclear and chloroplast genes. For instance, the Rieske Fe-S protein plays a key role in complex assembly, with its absence leading to increased turnover of other components . Extending these studies to A. formosae can clarify whether similar assembly mechanisms operate in early-diverging land plants.

  • Alternative Electron Transport Pathways: Detailed characterization of A. formosae cytochrome b6 could reveal lineage-specific adaptations in electron transport pathways, potentially identifying alternative routes or regulatory mechanisms not present in more derived plant lineages.

What are the key challenges and opportunities in A. formosae cytochrome b6 research?

Research on A. formosae cytochrome b6 presents several significant challenges and opportunities:

  • Technical Challenges: Developing efficient heterologous expression systems for properly folded and functional A. formosae cytochrome b6 remains challenging, particularly considering the extensive post-transcriptional modifications required. Researchers must carefully design expression constructs based on edited cDNA sequences rather than genomic sequences .

  • RNA Editing Machinery: The mechanisms underlying the extensive and bidirectional RNA editing in A. formosae remain poorly understood. Identifying the specific trans-acting factors and cis-elements responsible for this remarkable editing landscape represents both a significant challenge and an exciting research opportunity .

  • Evolutionary Significance: Further comparative studies of cytochrome b6 across hornwort species with varying RNA editing frequencies could provide crucial insights into the evolutionary significance and functional consequences of RNA editing in early land plants .

  • Structural Biology Opportunities: Detailed structural characterization of A. formosae cytochrome b6, particularly comparing the structures of edited and unedited versions, could reveal how specific amino acid changes influence protein folding, stability, and function. This knowledge would enhance our understanding of structure-function relationships in electron transport proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.