Recombinant Anthoceros formosae Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Recombinant Anthoceros formosae Cytochrome c Biogenesis Protein ccsA (ccsA): Overview

The Recombinant Anthoceros formosae Cytochrome c Biogenesis Protein ccsA (UniProt ID: Q85A51) is a full-length recombinant protein expressed in E. coli with an N-terminal His tag. It plays a critical role in cytochrome c biogenesis, facilitating heme transfer and ligation in chloroplasts. This protein is of particular interest in plant molecular biology due to its unique structural and functional properties, including RNA editing-dependent activation in its native state .

Core Mechanisms

  1. Heme Delivery: ccsA facilitates the transfer of reduced (Fe²⁺) heme from the cytoplasm to the chloroplast stroma, where it is ligated to apocytochrome c .

  2. RNA Editing: The native ccsA transcript undergoes RNA editing to convert the non-canonical initiation codon ACG to AUG, ensuring proper translation .

  3. Protein-Protein Interactions: In chloroplasts, ccsA likely interacts with other components (e.g., DsbD, CcsX) to form a functional complex for cytochrome c assembly .

Recombinant Protein Utility

ApplicationDetails
ELISA StudiesUsed as an antigen in immunoassays to detect anti-ccsA antibodies .
Structural AnalysisPurified recombinant ccsA enables NMR/X-ray crystallography for domain mapping .
Functional ComplementationRescues cytochrome c biogenesis defects in E. coli deletion mutants .

Key Experimental Observations

  1. Heme Binding: Mutations in external histidines (e.g., H761A, H897A) disrupt heme coordination, causing oxidation to Fe³⁺ and loss of synthetic activity .

  2. Imidazole Rescue: Exogenous imidazole restores heme binding in TMD histidine mutants, mimicking a low-affinity channel for heme transport .

  3. RNA Editing Dependency: Native ccsA requires RNA editing for functional activity, a process absent in recombinant E. coli-produced protein .

Comparative Analysis with Bacterial Homologs

FeatureAnthoceros ccsABacterial CcsBA
LocalizationChloroplast stroma (soluble)Bacterial periplasm (membrane-bound)
Heme TransportLikely via soluble intermediatesDirect transmembrane channel
RNA EditingRequired for native activity Not applicable
Functional PartnersDsbD, CcsXCcsBA (fused CcsB-CcsA)

Challenges and Future Directions

  • Mechanistic Gaps: The exact pathway for heme transfer from thylakoid membranes to ccsA remains unclear.

  • Therapeutic Potential: Studies on ccsA homologs in pathogens (e.g., Helicobacter) highlight its role as a drug target for cytochrome c-dependent diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
ccsA
Target Protein Sequence
MILINLEHILAHISFFLPFLATLVFWGRIVCIDNKRIGSLGNKSIIIAYICITGLLLTRW FHSRHLLLSNLYESFMFLSWSFCLIHIVSEIGSKNDWLGIIIVLIAMLTHGFATVGLPIE MQQSTVLVPALQSHWLIMHVSMMIPSYATLPCGSLLVIALLITTLNKNKNFPILKFNVNS FIWSLILEKKFYLGGSGGDISSRNSSSGNGSDNDSNNNNNKKTFHSLSIDCRKLQLTQQL DYWSYRIISLGSLFLTIGILSGAVWVNEAWGSYWSWDPKETWALITWLLSAIHIHIRMIR GWQGEKPAIIASSGSSIVWFRYLGVNSPEKGLHSYGWLN
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the ccsA gene in Anthoceros formosae?

The ccsA gene in Anthoceros formosae is located within the chloroplast genome, which is 161,162 bp in length and divided into two regions by a pair of inverted repeat regions (IR) of 15,744 bp each . The gene contains conserved regions typical of the ccsA family, including the highly conserved tryptophan-rich WWD domain that is proposed to be involved in heme binding .

Within the sequence structure, notable features include:

  • Total gene length: Approximately 960-1000 bp (inferred from comparable species)

  • Codon usage pattern: Optimized for chloroplast expression

  • RNA editing sites: Multiple C→U and U→C conversions have been identified in transcript

  • Conserved motifs: WWD domain and transmembrane regions

Experimental approach for gene analysis:

  • PCR amplification using primers designed from genomic sequence 20-50 nt upstream and downstream of the coding region

  • Direct sequencing with the Prism Dye Terminator Cycle sequencing kit

  • cDNA synthesis from total RNA isolated using CTAB method with slight modifications

  • Comparative analysis with other plant species

How does the ccsA protein function in cytochrome c biogenesis?

The ccsA protein functions as a critical component of cytochrome c synthesis machinery in chloroplasts. It belongs to a superfamily of integral membrane proteins that facilitate the attachment of heme to c-type cytochromes . The protein plays dual roles in cytochrome c biogenesis:

  • Heme export: CcsA assists in transporting heme from its site of synthesis to the site of cytochrome assembly .

  • Heme protection: It maintains heme in a reduced state by protecting the iron from oxidation through histidine coordination .

  • Attachment facilitation: It provides the catalytic site for stereospecific attachment of heme to the CXXCH motif in apo-cytochromes.

The functional domains of ccsA include:

  • An external heme binding domain containing two histidine residues that serve as axial ligands

  • Transmembrane domains with conserved histidines that create a heme transfer pathway

  • A catalytic site that facilitates thioether bond formation between heme and cytochrome c

Mutations in the ccsA gene result in non-photosynthetic phenotypes due to the absence of functional c-type cytochromes, demonstrating its essential role in photosynthesis .

What methodologies can be used to express recombinant Anthoceros formosae ccsA protein?

Expression of recombinant A. formosae ccsA presents unique challenges due to its membrane-bound nature and chloroplast origin. Recommended methodological approaches include:

  • Heterologous Expression Systems:

    • E. coli: Using specialized strains (C41/C43) optimized for membrane protein expression

    • Chlamydomonas reinhardtii: Chloroplast transformation for homologous expression environment

    • Cell-free systems: For difficult-to-express membrane proteins

  • Expression Optimization Protocol:

    • Codon optimization for the selected expression system

    • Addition of fusion tags (His, MBP, GST) for purification and solubility

    • Incorporation of signal sequences for proper membrane targeting

    • Temperature reduction (16-20°C) during induction to improve folding

  • Purification Strategy:

    • Gentle detergent extraction (DDM, LMNG) to maintain protein structure

    • IMAC purification for His-tagged constructs

    • Size exclusion chromatography for final polishing

  • Validation Methodologies:

    • Western blotting with anti-ccsA antibodies

    • Functional complementation in ccsA-deficient strains

    • Heme binding assays using spectroscopic methods

The expression should be validated through functional assays to confirm the recombinant protein retains heme binding and attachment capabilities .

How do the transmembrane histidines in ccsA facilitate heme trafficking?

The ccsA protein contains critical histidine residues within its transmembrane domains (TMDs) that play essential roles in heme trafficking from the site of synthesis to the external heme binding domain. Current research indicates a sophisticated mechanism:

  • Histidine Relay System: The two conserved histidines in TMDs create a "relay" system that coordinates with heme iron during transport . These residues likely serve as intermediate ligands during heme translocation across the membrane.

  • Experimental Evidence: When TMD histidines are mutated, heme fails to reach the external binding domain. Remarkably, exogenous imidazole can functionally rescue these mutants, suggesting direct involvement in heme coordination .

  • Proposed Trafficking Mechanism:

StepProcessMolecular ComponentsDetection Method
1Initial heme captureTMD histidine near stromal faceUV-visible spectroscopy
2Heme translocationConserved histidine relaySite-directed mutagenesis
3Heme deliveryExternal histidinesResonance Raman spectroscopy
4Heme presentation to cytochromeWWD domainCross-linking studies
  • Research Methodology:

    • Site-directed mutagenesis of histidine residues

    • Heme binding assays using various spectroscopic techniques

    • Imidazole rescue experiments at varying concentrations

    • Molecular dynamics simulations to model heme movement

This histidine relay system represents an elegant solution for moving heme across the membrane while protecting it from oxidation, similar to other heme trafficking systems but uniquely adapted for cytochrome c synthesis .

How does RNA editing affect ccsA function in Anthoceros formosae?

RNA editing is particularly prevalent in hornwort chloroplast transcripts, with 507 C→U and 432 U→C conversions identified across the Anthoceros formosae chloroplast genome . These editing events have significant implications for ccsA function:

  • Editing Patterns in ccsA:

    • Multiple editing sites occur within the coding sequence

    • Editing can alter amino acid identity, potentially affecting protein structure and function

    • Some editing events create functional start codons or eliminate premature stop codons

  • Functional Consequences:

    • Restoration of conserved amino acids: RNA editing often restores evolutionary conserved amino acids

    • Protein conformation effects: Altered amino acids may affect transmembrane domain organization

    • Activity modulation: Editing can fine-tune protein activity under different conditions

  • Research Protocol for RNA Editing Analysis:

    • Total RNA isolation using modified CTAB method

    • cDNA synthesis with gene-specific primers

    • Comparative sequencing of genomic DNA and cDNA

    • Mapping editing sites to protein domains to predict functional impacts

  • Experimental Verification Approach:

    • Expression of edited vs. unedited protein versions

    • Functional complementation in ccsA mutants

    • Protein structure analysis using cryo-EM or crystallography

    • Heme binding and attachment assays to measure functional differences

The extensive RNA editing in Anthoceros formosae represents an additional layer of regulation that may be particularly important for membrane proteins involved in essential processes like cytochrome biogenesis .

What is the evolutionary significance of the ccsA gene structure in bryophytes compared to other plant lineages?

The ccsA gene structure in bryophytes, particularly in hornworts like Anthoceros formosae, provides valuable insights into the evolution of photosynthetic machinery during land plant diversification:

  • Comparative Genomic Analysis:

Plant GroupccsA LocationGene StructureNotable Features
Hornworts (Anthoceros)Chloroplast genomeNumerous RNA editing sitesLargest chloroplast genome (161,162 bp)
Liverworts & MossesChloroplast genomeFewer RNA editing sitesSimilar gene arrangement
Ferns & LycophytesChloroplast genomeModerate RNA editingConserved transmembrane regions
GymnospermsChloroplast genomeLimited RNA editingSimilar protein structure
AngiospermsChloroplast genomeMinimal RNA editingHighly conserved WWD domain
  • Evolutionary Implications:

    • The ccsA gene is universally retained in photosynthetic eukaryotes, indicating essential function

    • Sequence comparison suggests strong purifying selection on functional domains

    • RNA editing patterns show lineage-specific adaptation

    • Hornwort ccsA contains unique repeats not found in other lineages

  • Research Approach:

    • Phylogenetic reconstruction using ccsA sequences from diverse plant lineages

    • Selection pressure analysis using dN/dS ratio calculation

    • Ancestral sequence reconstruction to track evolutionary changes

    • Structural modeling to identify conserved functional domains

  • Evolutionary Hypotheses:

    • Hornwort ccsA represents an ancestral state in land plants

    • Differences in RNA editing reflect adaptation to different photosynthetic requirements

    • Conserved domains indicate evolutionary constraints on function

    • Repetitive elements in ccsA may influence gene expression or protein function

The evolutionary analysis of ccsA across plant lineages provides a window into the adaptation of photosynthetic apparatus during the conquest of land by plants .

How does the three-dimensional structure of ccsA facilitate its dual functions in heme export and cytochrome c synthesis?

The three-dimensional structure of ccsA is central to understanding its dual role in heme export and cytochrome c synthesis. While a high-resolution structure of Anthoceros formosae ccsA is not yet available, structural models based on related proteins and experimental evidence suggest the following:

  • Structural Organization:

    • 10 transmembrane domains creating a channel-like structure

    • External heme binding domain with crucial histidine residues

    • WWD domain positioned for interaction with apocytochrome c

    • Potential dimerization interfaces for interaction with partner proteins

  • Structure-Function Relationships:

DomainStructural FeaturesFunctional RoleExperimental Evidence
Transmembrane domainsHistidine residues creating channelHeme translocation pathwayImidazole rescue of histidine mutants
External domainHistidine coordination sitesHeme protection from oxidationUV-visible spectroscopy showing reduced heme
WWD domainTryptophan-rich regionApocytochrome recognitionMutation studies showing loss of attachment
C-terminal regionCharged residuesProtein-protein interactionsCross-linking with partner proteins
  • Methodological Approaches for Structural Analysis:

    • Cryo-electron microscopy of purified protein

    • X-ray crystallography (challenging for membrane proteins)

    • Molecular dynamics simulations based on homology models

    • Cross-linking mass spectrometry to identify interaction surfaces

    • EPR spectroscopy to analyze heme environment

  • Structure-Based Mechanistic Model:

    • Heme enters through a defined portal from the stromal side

    • Transmembrane histidines relay heme through the membrane

    • External histidines capture and maintain heme in reduced state

    • WWD domain positions heme for stereospecific attachment to CXXCH motif

    • Conformational changes facilitate release of holocytochrome c

Understanding this structure-function relationship is crucial for explaining how ccsA participates in both heme trafficking and the enzymatic attachment of heme to cytochromes .

What technical challenges exist in studying recombinant ccsA function, and how can they be addressed?

Studying recombinant ccsA function presents several technical challenges due to its nature as an integral membrane protein involved in complex biochemical processes. These challenges and their potential solutions include:

  • Membrane Protein Expression and Purification:

    • Challenge: Low expression yields and protein instability

    • Solution: Use specialized expression hosts (C41/C43 E. coli), fusion partners (MBP, SUMO), and optimized detergents (LMNG, GDN) for extraction

  • Functional Reconstitution:

    • Challenge: Maintaining activity outside native membrane environment

    • Solution: Reconstitution into nanodiscs or liposomes with defined lipid composition to mimic native environment

  • Assaying Heme Binding and Transport:

    • Challenge: Distinguishing bound vs. free heme and tracking heme movement

    • Solution: Develop fluorescent heme analogs, resonance energy transfer assays, or pulse-chase experiments with isotopically labeled heme

  • Measuring Cytochrome c Synthetase Activity:

    • Challenge: Recreating all components of the cytochrome c maturation system

    • Solution: Develop a reconstituted system with purified components or use membrane fractions from expression hosts

  • Advanced Methodological Approaches:

ChallengeConventional ApproachAdvanced SolutionExpected Improvement
Protein solubilityDetergent screeningStyrene maleic acid copolymer (SMA) extractionNative lipid environment retention
Function verificationComplementation in vivoSingle-molecule fluorescence assaysDirect observation of mechanism
Structure determinationX-ray crystallographyCryo-EM with improved detergents/stabilizersHigher resolution structures
Interaction mappingCo-immunoprecipitationHydrogen-deuterium exchange mass spectrometryDynamic interaction surfaces
Heme trackingAbsorption spectroscopyTime-resolved fluorescence with labeled hemeReal-time trafficking visualization
  • Integrated Systems Approach:

    • Combine structural, biochemical, and genetic approaches

    • Develop cell-free expression systems optimized for membrane proteins

    • Use computational models to guide experimental design

    • Apply synthetic biology to reconstruct minimal functional systems

Overcoming these technical challenges will provide deeper insights into the mechanism of cytochrome c biogenesis and may have applications in synthetic biology and biotechnology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.