Recombinant Anthoceros formosae NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
ndhC
Target Protein Sequence
MFLVSKYNYFWIFLLIASLIPTIAFSISRVIAPISKGPEKFTSYECGIEPMGDAWIQFQI RYYMFALVFVIFDVETVFLYPWAMSFKQLGIPAFIEVFIFVFILIIGLIYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Anthoceros formosae NAD(P)H-quinone oxidoreductase subunit 3, and why is it significant for research?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a chloroplast-encoded protein component of the NAD(P)H dehydrogenase complex in the hornwort species Anthoceros formosae. This protein is particularly significant for research because:

  • It is encoded within the largest known chloroplast genome among land plants (161,162 bp)

  • It belongs to hornworts, which occupy a crucial phylogenetic position for understanding early land plant evolution

  • It exhibits extensive RNA editing, including both C-to-U and U-to-C conversions, making it valuable for studying RNA editing mechanisms

The protein functions as part of the chloroplast electron transport chain, participating in cyclic electron flow around photosystem I. This process is important for balancing the ATP/NADPH ratio required for carbon fixation.

How can researchers purify and reconstitute recombinant Anthoceros formosae ndhC for functional studies?

Purification and reconstitution of recombinant Anthoceros formosae ndhC protein can be performed using the following methodology:

  • Expression system selection:

    • E. coli is the preferred heterologous expression system for this protein

    • Expression constructs should include an N-terminal His-tag for purification purposes

  • Purification protocol:

    • Use affinity chromatography with Ni-NTA resin to capture the His-tagged protein

    • Elute using imidazole gradient buffers

    • Further purify using size exclusion chromatography if necessary

  • Reconstitution considerations:

    • Lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage (recommended 50%)

    • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Storage recommendations:

    • Store working aliquots at 4°C for up to one week

    • For longer storage, maintain at -20°C/-80°C

    • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

What experimental methods are used to verify the functionality of recombinant ndhC protein?

To verify the functionality of recombinant Anthoceros formosae ndhC protein, researchers employ several complementary approaches:

  • Spectrophotometric enzyme assays:

    • Measure NAD(P)H oxidation rates using various electron acceptors (quinones)

    • Monitor absorbance changes at 340 nm (NAD(P)H absorption peak)

    • Calculate enzyme kinetic parameters (Km, Vmax)

  • Protein quality assessment:

    • SDS-PAGE to verify purity (should be >90%)

    • Western blotting using anti-His antibodies to confirm identity

    • Mass spectrometry to verify the correct molecular weight and sequence

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs for membrane protein studies

    • Assembly with other NAD(P)H dehydrogenase complex subunits

    • Electron transport measurements using artificial electron donors/acceptors

  • Structural integrity validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to evaluate proper folding

How does the genomic context of ndhC differ between Anthoceros formosae and other land plants?

The genomic context of ndhC in Anthoceros formosae shows several notable differences compared to other land plants:

  • Chloroplast genome organization:

    • The Anthoceros formosae chloroplast genome (161,162 bp) is the largest among land plants

    • It contains a larger inverted repeat (IR) region (15,744 bp each) compared to the liverwort Marchantia

    • The genome is divided into large single copy region (107,503 bp) and small single copy region (22,171 bp)

  • Gene arrangement:

    • The gene order of ndhK, ndhC, trnV, trnM, atpE, atpB, rbcL, trnR, and accD is conserved between Anthoceros and other chloroplast genomes

    • Unlike the liverwort Marchantia, Anthoceros contains duplicate copies of ndhB and rps7 genes and the 3′ exon of rps12

  • Comparative structure among hornworts:

    • The ndhC gene structure in Anthoceros differs from that in Nothoceros aenigmaticus, another hornwort species

    • Nothoceros has several gene regions located in the large single-copy region that are within the IR in Anthoceros

  • Evolutionary implications:

    • The unique genomic context of ndhC in Anthoceros provides insights into chloroplast genome evolution in early land plants

    • These differences help resolve the phylogenetic relationships among bryophytes and early land plant lineages

What is the significance of RNA editing in the ndhC transcript of Anthoceros formosae, and how can researchers study this phenomenon?

RNA editing in the ndhC transcript of Anthoceros formosae represents a critical evolutionary and functional phenomenon with significant implications:

  • Unique editing patterns:

    • Anthoceros formosae exhibits both C-to-U and U-to-C RNA editing events

    • The U-to-C editing is particularly significant as it was previously unknown in chloroplasts

    • Over half of the protein-coding genes have nonsense codons converted to sense codons by RNA editing

  • Methodological approach to study RNA editing:

    • Classify editing events based on conservation impact (conservative, non-conservative, synonymous)

    • Analyze editing site distributions across different gene regions and functional domains

  • Evolutionary significance:

    • U-to-C editing may be a molecular synapomorphy (shared derived trait) of a hornwort-tracheophyte clade

    • The presence of RNA editing in hornworts but not in liverworts suggests either:
      a) The event arose in the first land plants and disappeared from liverworts
      b) It arose in the common ancestor of hornworts and vascular plants

    • The high frequency of RNA editing events in Anthoceros (>1100 sites of C-to-U and >1300 sites of U-to-C) contrasts with the much lower frequency in Leiosporoceros, suggesting fluctuation during hornwort diversification

  • Molecular machinery:

    • RNA editing in plant organelles involves pentatricopeptide repeat (PPR) proteins

    • The Anthoceros agrestis nuclear genome contains >1400 genes for PPR proteins with variable carboxyterminal DYW domains

    • These proteins are candidate factors for both C-to-U and U-to-C editing events

How can researchers address contradictions in experimental data when working with recombinant Anthoceros formosae ndhC?

Contradictions in experimental data are common challenges in research involving recombinant proteins like Anthoceros formosae ndhC. Addressing these issues requires systematic approaches:

  • Classification of contradiction types:

    • Self-contradictions within a single dataset

    • Pair contradictions between two different datasets

    • Conditional contradictions involving three or more datasets with conditional relationships

  • Structured methodology for contradiction resolution:

    • Define contradiction patterns using the (α, β, θ) notation :

      • α: number of interdependent items

      • β: number of contradictory dependencies defined by domain experts

      • θ: minimal number of required Boolean rules to assess contradictions

    • Apply Boolean minimization techniques to reduce complex contradiction patterns

    • Implement a generalized contradiction assessment framework

  • Practical strategies for ndhC research:

    • Experimental design considerations:

      • Include appropriate controls for each variable

      • Maintain consistent protein preparation protocols

      • Document all experimental conditions meticulously

      • Use multiple methods to verify key findings

    • Data analysis approach:

      • Apply statistical methods to distinguish significant differences from random variation

      • Implement computational modeling to reconcile contradictory observations

      • Develop a structured notation system for tracking contradictions across experiments

      • Utilize the contradiction pattern analysis described in search result

  • Case study: Resolving contradictions in RNA editing patterns:

    • When contradictory RNA editing patterns are observed across studies:

      • Compare sequence quality and coverage metrics

      • Evaluate tissue-specific or developmental stage differences

      • Consider potential technical artifacts from cDNA synthesis

      • Assess evolutionary differences between closely related species

What evolutionary insights can be gained from studying Anthoceros formosae ndhC in the context of land plant evolution?

Studying Anthoceros formosae ndhC provides valuable evolutionary insights into land plant evolution:

  • Phylogenetic significance of hornworts:

    • Hornworts occupy a pivotal position in land plant evolution

    • Recent phylogenomic analyses place hornworts as a sister clade to liverworts plus mosses with high support

    • Understanding ndhC evolution helps clarify the relationships among early land plant lineages

  • Evolutionary implications of RNA editing:

    • The discovery of RNA editing in Anthoceros but not in the liverwort Marchantia polymorpha suggests two possibilities :
      a) RNA editing arose in the first land plants and was subsequently lost in liverworts
      b) RNA editing emerged in the common ancestor of hornworts and vascular plants

    • U-to-C editing may represent a molecular synapomorphy of a hornwort-tracheophyte clade

  • Comparative genomic approach:

    • Comparing ndhC across species reveals evolutionary patterns:

    SpeciesChloroplast Genome SizeIR SizendhC FeaturesRNA Editing
    Anthoceros formosae161,162 bp15,744 bpLocated in LSC regionC-to-U and U-to-C
    Marchantia polymorphaSmallerSmallerSimilar locationNone reported
    Nothoceros aenigmaticusSimilar to other bryophytesSmaller than AnthocerosDifferent position relative to IRPresent
  • Molecular clock analysis:

    • The molecular evolutionary rate of ndhC can be used to calibrate divergence times

    • Phylogenetic analysis based on 11,518 amino acid sites of 52 genes encoded in chloroplast genomes suggests that liverworts are sister to all other land plants

    • Analysis of hornwort ndhC contributes to understanding the earliest land plant lineages that diverged >400 million years ago

How can researchers optimize expression systems for producing functional recombinant Anthoceros formosae ndhC protein?

Optimizing expression systems for functional recombinant Anthoceros formosae ndhC requires careful consideration of several factors:

  • Host selection considerations:

    • E. coli expression systems:

      • Advantages: Well-established protocols, high yields, ease of genetic manipulation

      • Limitations: Potential issues with membrane protein folding, lack of post-translational modifications

      • Optimization: Use specialized strains (C41/C43) designed for membrane protein expression

      • Current approach: Successfully used for ndhC expression with N-terminal His-tag

    • Alternative expression hosts:

      • Chloroplast-based expression systems (tobacco, Chlamydomonas)

      • Yeast systems (P. pastoris, S. cerevisiae) for better membrane protein folding

      • Cell-free expression systems for difficult-to-express proteins

  • Vector design strategies:

    • Fusion partners to enhance solubility:

      • MBP (maltose-binding protein)

      • SUMO (small ubiquitin-like modifier)

      • Thioredoxin

    • Codon optimization:

      • Adapt codon usage to match expression host

      • Remove rare codons that might cause translational pausing

    • Signal sequences:

      • Add appropriate signal peptides for membrane targeting

      • Consider using native chloroplast transit peptides

  • Expression condition optimization:

    • Temperature modulation:

      • Lower temperatures (16-20°C) often improve membrane protein folding

      • Extended expression times at reduced temperatures

    • Induction strategies:

      • Test various inducer concentrations

      • Evaluate auto-induction media systems

    • Media supplementation:

      • Add membrane-stabilizing compounds

      • Include cofactors required for proper folding

  • Purification and stabilization:

    • Detergent screening:

      • Test multiple detergent types for optimal extraction and stability

      • Consider native-like nanodiscs or liposomes for final formulation

    • Buffer optimization:

      • Current recommendation: Tris/PBS-based buffer, pH 8.0, with 6% trehalose

      • Addition of 50% glycerol for long-term storage

    • Reconstitution protocol:

      • Reconstitute lyophilized protein in deionized sterile water (0.1-1.0 mg/mL)

      • Aliquot to avoid repeated freeze-thaw cycles

What are the current methodological approaches to study RNA editing mechanisms in ndhC and other chloroplast genes in Anthoceros formosae?

Studying RNA editing mechanisms in ndhC and other chloroplast genes in Anthoceros formosae involves sophisticated methodological approaches:

  • Comprehensive editome analysis:

    • Bioinformatic analysis:

      • Apply computational pipelines specifically designed to detect editing events

      • Classify editing sites based on impact (silent, conservative, non-conservative)

      • Analyze editing site distributions across gene regions and functional domains

  • Identifying RNA editing factors:

    • Candidate gene approach:

      • Focus on pentatricopeptide repeat (PPR) proteins with DYW domains

      • The Anthoceros nuclear genome contains >1400 PPR protein genes

      • DYW domains function as cytidine deaminases for C-to-U editing

      • Significant variants of the "classic" DYW domain may be involved in U-to-C editing

    • RNA-protein interaction studies:

      • RNA electrophoretic mobility shift assays (REMSA)

      • RNA immunoprecipitation (RIP)

      • Cross-linking and immunoprecipitation (CLIP)

      • Apply the PPR-RNA binding code to predict interactions between PPR proteins and editing sites

  • Functional characterization of editing events:

    • Site-directed mutagenesis:

      • Generate constructs with genomic (unedited) and edited versions of ndhC

      • Express both versions in heterologous systems

      • Compare protein stability, activity, and integration into protein complexes

    • Structural analysis:

      • Model the structural consequences of amino acid changes resulting from RNA editing

      • Predict effects on protein folding, stability, and function

      • Use cryo-EM or crystallography to validate structural models

  • Evolutionary analysis of RNA editing:

    • Comparative approach:

      • Compare editing patterns across hornwort species and other land plants

      • Analyze conservation of editing sites in relation to protein function

      • Study editing site gain/loss across evolutionary time

    • Selection analysis:

      • Test for positive or purifying selection at edited sites

      • Evaluate the correlation between editing efficiency and functional importance

      • Investigate the co-evolution of editing sites and editing factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.