Recombinant Anthoceros formosae NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The ndhG subunit is part of the chloroplast NAD(P)H dehydrogenase-like (NDH) complex, a multi-subunit enzyme embedded in thylakoid membranes. It facilitates cyclic electron transport (CET) around photosystem I (PSI), essential for ATP synthesis and stress adaptation in plants . Recombinant ndhG refers to the protein produced via heterologous expression systems (e.g., mammalian cells) for functional and structural studies .

Genomic Organization

  • The chloroplast genome of A. formosae (161,162 bp) encodes ndhG alongside 10 other NDH subunits (ndhA–K) .

  • ndhG is located in the small single-copy (SSC) region of the chloroplast genome, adjacent to ndhE and ndhD .

Protein Features

  • Length: Partial sequences of recombinant ndhG are commonly produced due to technical constraints .

  • Post-Translational Modifications: RNA editing in A. formosae chloroplasts introduces U→C and C→U conversions, correcting nonsense codons and ensuring functional protein synthesis .

Functional Role in the NDH Complex

The NDH complex is divided into subcomplexes:

SubcomplexSubunitsFunction
MembranendhA–GProton translocation
Subcomplex AndhH–K, nuclear subunitsFerredoxin binding, electron transfer
Subcomplex BPlant-specific nuclear subunitsStabilization under stress

ndhG contributes to the membrane subcomplex, aiding proton pumping and CET .

Expression Systems

  • Host: Mammalian cells (e.g., HEK293) .

  • Purity: >85% (SDS-PAGE verified) .

  • Storage: Lyophilized or liquid forms at -20°C/-80°C; glycerol (5–50%) enhances stability .

Research Applications

  • Functional Studies: Used to dissect NDH assembly mechanisms .

  • Stress Response Models: ndhG knockout mutants in tobacco show heightened sensitivity to oxidative stress, linking CET to photoprotection .

Evolutionary and Comparative Insights

  • Conservation: ndhG is retained in most land plants but lost in heterotrophic species (e.g., parasites) .

  • Divergence: Hornwort ndhG shares 60–70% sequence identity with liverwort (Marchantia) homologs, yet exhibits unique RNA editing patterns .

Key Research Findings

  • RNA Editing: Over 50% of A. formosae chloroplast genes require RNA editing to produce functional proteins. In ndhG, editing corrects ACG→AUG start codons and UGA→CGA stop codons .

  • Assembly Mechanism: ndhG integrates into the NDH membrane subcomplex during early stromal assembly stages, guided by chaperonins like Cpn60β4 .

  • Stress Adaptation: ndhG-containing NDH complexes mitigate photooxidative damage by regulating electron flow under high light or temperature stress .

Future Directions

  • Structural Biology: Cryo-EM studies are needed to resolve ndhG’s role in NDH-PSI supercomplex formation .

  • Biotechnological Engineering: Optimizing recombinant ndhG expression could enhance crop resilience to environmental stressors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please include it in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its implementation whenever feasible.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Anthoceros formosae (Hornwort)
Target Names
ndhG
Target Protein Sequence
MNIINLPELNYEVFFVFIELGLIFGSLGVVFLTNIVYSAFLLGLVFVCISFLYLLLDADF VATAQILIYVGAVNILIVFAVMLINKPQSLQFLPSWTVGDTITLILCTSLFFLLISMILS ISWSNIFSIAQSNKIGEQVLKSSVQGIGSSLLIDFLLPFELLSIVLLVALIGAITIARRE KKVKLQKNRTLQVTKDSFIL
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be plastoquinone. This process couples the redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of ndhG in the Anthoceros formosae chloroplast?

The ndhG gene is located within the chloroplast genome of Anthoceros formosae, which at 161,162 bp represents the largest genome reported among land plant chloroplasts. This genome is divided into two regions by a pair of inverted repeat regions (IR) of 15,744 bp each, with large and small single copy regions of 107,503 and 22,171 bp, respectively . The ndhG gene is one of several ndh genes (including ndhA, ndhB, ndhC, ndhD, ndhE, ndhF, ndhG, ndhH, ndhI, ndhJ, and ndhK) that encode components of the chloroplast NAD(P)H dehydrogenase complex. Unlike some other ndh genes that may be pseudogenized in certain plant species, ndhG is fully functional in Anthoceros formosae .

What RNA editing patterns occur in ndhG transcripts of Anthoceros formosae?

RNA editing is particularly extensive in the transcripts of Anthoceros formosae chloroplast genes, including ndhG. The hornwort exhibits both C→U and U→C conversions in ndh gene transcripts, with a total of 507 C→U and 432 U→C conversions identified across all chloroplast genes . For the ndh genes specifically, RNA editing events are critical for proper protein function, often converting nonsense codons into sense codons (164 instances documented where UGA, UAA, and UAG are converted to CGA, CAA, and CAG, respectively). This extensive RNA editing represents one of the most comprehensive editing patterns known in plant chloroplasts and significantly impacts the functionality of the resulting NdhG protein .

What is the physiological role of the ndhG-containing NDH complex in chloroplasts?

The ndhG protein functions as a subunit of the chloroplast NAD(P)H dehydrogenase (NDH) complex, which plays crucial roles in both cyclic electron transport and chlororespiration. The complex catalyzes the oxidoreduction of plastoquinone (PQ), with the reaction:

NADH + H⁺ + PQ → NAD⁺ + PQH₂

This reaction is integral to cyclic electron transport around photosystem I, allowing for additional ATP synthesis without NADPH production. The complex also contributes to chlororespiration, a respiratory-like electron transport process in chloroplasts that functions in the dark . The NDH complex containing ndhG provides several advantages for land plants:

FunctionPhysiological Benefit
Enhanced cyclic electron transportAdditional ATP synthesis for CO₂ fixation
ChlororespirationElectron transport during dark periods
Stress protectionImproved photosynthetic efficiency under environmental stresses
Redox balanceMaintenance of optimal redox status in the chloroplast

These functions are particularly important for plants adapting to terrestrial environments with fluctuating light conditions and various environmental stresses .

Why are ndh genes, including ndhG, conserved in land plants but lost in most algae?

The conservation pattern of ndh genes provides fascinating insights into plant evolution. While most algae lineages have lost ndh genes, these genes are consistently conserved in the plastid DNAs of the phylum Streptophyta and derived land plants . This conservation pattern strongly suggests that ndh genes, including ndhG, provide significant advantages for adaptation from aquatic to terrestrial environments.

The selective pressure to maintain ndh genes in land plants appears related to their role in protection against various terrestrial stresses. Plants lacking functional ndh genes show impaired photosynthetic activity, especially under fluctuating light intensities and high atmospheric CO₂ concentrations . The NDH complex improves photosynthesis efficiency, decreases entropy production, and protects leaves against various stresses including:

  • Light intensity fluctuations

  • Temperature variations

  • Drought stress

  • High CO₂ conditions

  • Photo-oxidative damage

This protective role becomes particularly important in terrestrial environments where plants face more variable and challenging conditions compared to aquatic habitats .

How does the enzymatic function of ndhG compare with mitochondrial and bacterial homologs?

FeatureChloroplast NDH (including ndhG)Mitochondrial/Bacterial Complex I
Electron donorNADH or potentially NADPHNADH
Electron acceptorPlastoquinoneUbiquinone
LocationThylakoid membranesInner mitochondrial membrane/Cell membrane
Primary functionCyclic electron transport, chlororespirationRespiratory electron transport
Proton pumpingYes, contributes to ΔpHYes, contributes to proton motive force
Relative abundanceLow (0.2% of thylakoid protein)Higher abundance

While the core catalytic function of electron transport is similar, the chloroplast NDH complex containing ndhG has evolved specialized roles in photosynthetic organisms. The two-electron reduction of quinones by NDH prevents unwanted one-electron reduction that would generate reactive oxygen species through redox cycling of semiquinones .

What are the standard protocols for isolating and studying native ndhG from Anthoceros formosae?

Isolation and study of native ndhG from Anthoceros formosae requires careful extraction of chloroplasts and subsequent analysis of the NDH complex. Based on established protocols for Anthoceros formosae research, the following methodology can be employed:

  • Thalli cultivation: Grow hornwort thalli on 1/2 KnopII-agar medium under controlled light and temperature conditions .

  • Chloroplast isolation:

    • Homogenize thalli in a buffer containing 50 mM Tris–HCl (pH 8.0), 10 mM EDTA, 20% sucrose, 5 mM 2-mercaptoethanol, and 0.1% BSA using a Waring blender.

    • Filter homogenate through cheesecloth and centrifuge at 1000 g for 10 seconds to remove unbroken cells.

    • Precipitate the chloroplast-rich fraction from the supernatant by centrifugation at 3000 g .

  • DNA extraction:

    • Extract chloroplast DNA using standard methods.

    • Amplify specific regions containing ndhG using PCR with primers designed from the genomic sequence .

  • RNA analysis:

    • Extract total RNA using the CTAB method.

    • Synthesize cDNA for chloroplast transcripts.

    • Amplify and sequence the ndhG coding region to identify RNA editing sites .

  • Protein analysis:

    • Isolate thylakoid membranes from purified chloroplasts.

    • Use Blue Native PAGE to separate intact NDH complex.

    • Perform western blotting with antibodies against NDH subunits to detect ndhG protein.

This approach allows for comprehensive analysis of native ndhG at the DNA, RNA, and protein levels.

What expression systems are most effective for producing recombinant Anthoceros formosae ndhG?

Producing recombinant ndhG presents several challenges due to its membrane protein nature and the potential requirement for specific folding environments and co-factors. Based on successful approaches with similar proteins, the following expression systems may be considered:

Expression SystemAdvantagesLimitationsModifications Needed
E. coli (bacterial)Fast growth, high yield, simple geneticsLacks chloroplast-specific chaperones and cofactorsCodon optimization, use of special strains (C41/C43), fusion tags
Chlamydomonas (algal)Natural chloroplast environmentLower yield, longer cultivation timeChloroplast transformation vectors
Tobacco (plant)Natural chloroplast environment, post-translational modificationsTime-consuming, variable expressionChloroplast transformation
Cell-free systemsAllows membrane protein expressionHigher cost, lower yieldSupplementation with lipids and chaperones

When expressing recombinant ndhG, several considerations are crucial:

  • The inclusion of the transit peptide may affect proper folding

  • RNA editing sites must be considered when designing the expression construct

  • The hydrophobic nature of membrane proteins requires appropriate detergents for solubilization

  • Co-expression with other NDH subunits may be necessary for proper complex assembly

For functional studies, expression in photosynthetic organisms like Chlamydomonas or tobacco chloroplasts may provide the most native-like environment for proper protein folding and assembly into the NDH complex.

How can researchers assess the enzymatic activity of recombinant ndhG and the NDH complex?

Assessing the enzymatic activity of recombinant ndhG as part of the NDH complex requires specialized approaches to measure electron transfer reactions. Researchers can employ the following methodologies:

  • Spectrophotometric assays:

    • Monitor the oxidation of NADH at 340 nm in the presence of plastoquinone analogs

    • Measure the reduction of artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP)

  • Polarographic assays:

    • Use an oxygen electrode to measure oxygen consumption during NDH activity

  • Chlorophyll fluorescence measurements:

    • Assess post-illumination fluorescence rise as an indicator of NDH activity

    • Measure non-photochemical quenching parameters

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Detect semiquinone intermediates during electron transfer

  • Electrochemical methods:

    • Use protein film voltammetry to measure direct electron transfer to electrodes

For comprehensive functional characterization, researchers should combine multiple approaches to assess different aspects of ndhG and NDH complex activity .

How does Anthoceros formosae ndhG compare phylogenetically with other plant species?

Phylogenetic analysis of ndhG and other plastid genes provides valuable insights into plant evolution. Based on comparative genomic data, Anthoceros formosae occupies a significant position in land plant phylogeny:

Plant GroupRepresentative SpeciesndhG StatusEvolutionary Significance
HornwortsAnthoceros formosaePresent, functionalRepresents early land plant lineage
LiverwortsMarchantia polymorphaPresent, functionalShows conservation across bryophytes
MossesPhyscomitrella patensPresent, functionalDemonstrates early land plant conservation
FernsPsilotum nudumPresent, functionalShows pteridophyte conservation
GymnospermsPinus thunbergiiPresent, functionalIndicates seed plant conservation
AngiospermsNicotiana tabacumPresent, functionalShows conservation in flowering plants
AlgaeChlorella vulgaris, Chaetosphaeridium globosumVariable presenceDemonstrates selective loss in algal lineages

Phylogenetic analyses using ndhG and 51 other genes (total of 11,518 amino acid sites) from diverse plant species allow researchers to reconstruct evolutionary relationships among land plants . The hornwort Anthoceros formosae possesses several distinctive features in its chloroplast genome, including the largest known land plant chloroplast genome (161,162 bp) and unique patterns of RNA editing, making it an important reference point for understanding chloroplast evolution .

Why do some photosynthetic plants lack ndh genes while Anthoceros formosae retains them?

The selective loss of ndh genes in certain plant lineages presents an evolutionary puzzle. While parasitic plants lacking photosynthetic activity predictably lose ndh genes, their absence in some fully photosynthetic plants is more intriguing . Several hypotheses explain this pattern:

  • Alternative cyclic electron transport pathways: Plants lacking ndh genes may rely on alternative pathways like the PGR5/PGRL1-dependent pathway for cyclic electron flow.

  • Environmental adaptation: The NDH complex provides particular advantages in certain environments but may be dispensable in others, leading to selective loss.

  • Energetic costs: Maintaining the large NDH complex may be energetically costly, creating selection pressure for gene loss when the complex provides limited benefits.

  • Genetic drift: Random genetic drift may have led to ndh gene loss in some lineages.

Anthoceros formosae and most land plants retain functional ndh genes because they provide significant advantages for adaptation to terrestrial environments with variable light conditions and multiple stresses . The extensive RNA editing in Anthoceros formosae ndh transcripts suggests strong selective pressure to maintain functional proteins despite potentially detrimental mutations in the DNA sequence .

What structural adaptations make the Anthoceros formosae NDH complex unique?

The NDH complex containing ndhG in Anthoceros formosae exhibits several distinctive structural features compared to other plant lineages:

  • RNA editing sites: The extensive RNA editing in Anthoceros formosae ndh transcripts (both C→U and U→C conversions) represents one of the most comprehensive editing patterns known and significantly impacts protein structure .

  • Subunit composition: While the core NDH subunits are conserved, the accessory subunits and assembly factors may differ between hornworts and other plant lineages.

  • Membrane association: The NDH complex in Anthoceros formosae is located in the stromal thylakoids, but its specific membrane topology and interaction with other photosynthetic complexes may have unique features .

  • Regulatory elements: The promoter regions and regulatory sequences controlling ndhG expression in Anthoceros formosae likely have lineage-specific features that influence expression patterns under different environmental conditions.

These structural adaptations reflect the evolutionary history of hornworts as an early diverging land plant lineage and their specific environmental adaptations .

How can CRISPR-Cas9 technology be applied to study ndhG function in Anthoceros formosae?

CRISPR-Cas9 genome editing offers powerful approaches for functional studies of ndhG in Anthoceros formosae, though applying this technology to hornworts presents unique challenges. A comprehensive research strategy might include:

  • Vector design considerations:

    • Design sgRNAs targeting specific regions of the ndhG gene

    • Optimize codon usage for Cas9 expression in Anthoceros formosae

    • Include appropriate selectable markers for transformation screening

  • Transformation methodology:

    • Develop protoplast isolation protocols specific for hornwort thalli

    • Optimize PEG-mediated transformation or biolistic delivery methods

    • Establish regeneration protocols for edited protoplasts

  • Editing strategies:

    • Create knockout mutants through NHEJ-mediated indels

    • Design precise edits mimicking natural RNA editing patterns

    • Introduce specific amino acid substitutions to test structure-function relationships

  • Phenotypic analysis of edited plants:

    • Assess photosynthetic parameters under various light intensities

    • Measure stress tolerance under drought, temperature fluctuations, and high light

    • Analyze cyclic electron transport using chlorophyll fluorescence techniques

  • Complementation studies:

    • Reintroduce wild-type or modified ndhG to confirm phenotypic rescue

    • Test ndhG genes from other plant species for functional complementation

This approach would provide unprecedented insights into ndhG function while establishing hornworts as a model system for studying early land plant adaptations .

What bioinformatic approaches can identify regulatory elements controlling ndhG expression?

Understanding the regulation of ndhG expression requires sophisticated bioinformatic analysis to identify cis-regulatory elements and their potential interactions. Researchers can employ the following computational approaches:

  • Comparative genomics:

    • Align promoter regions of ndhG from multiple plant species

    • Identify conserved non-coding sequences as potential regulatory elements

    • Use phylogenetic footprinting to detect evolutionarily conserved motifs

  • Motif discovery algorithms:

    • Apply tools like MEME, HOMER, or STREME to identify enriched sequence motifs

    • Compare identified motifs with known transcription factor binding sites

    • Cluster co-regulated genes to identify shared regulatory elements

  • Structural analysis:

    • Predict DNA secondary structures in promoter regions

    • Identify potential G-quadruplexes or other non-B DNA structures

    • Model chromatin accessibility based on DNA sequence features

  • Integration with experimental data:

    • Incorporate RNA-seq data to correlate expression patterns with regulatory elements

    • Use DAP-seq or ChIP-seq data (if available) to identify bound transcription factors

    • Validate predicted regulatory elements with reporter gene assays

These approaches can reveal the complex regulatory networks controlling ndhG expression under different environmental conditions and developmental stages, providing insights into the adaptive significance of ndh genes in land plants .

How do mutations in ndhG affect cyclic electron transport and photoprotection mechanisms?

The impact of ndhG mutations on photosynthetic function can be assessed through detailed biophysical and biochemical analyses. Based on research with ndh mutants in other plant species, the following effects might be observed:

Mutation TypeEffect on NDH ComplexPhotosynthetic ImpactStress Response
Null mutationAbsence of assembled complexReduced cyclic electron flowDecreased tolerance to fluctuating light
Missense mutationAltered electron transfer kineticsModified proton gradient formationVariable stress sensitivity
RNA editing site mutationPotentially non-functional proteinImpaired NDH-dependent cyclic electron transportReduced adaptation to high light
Promoter mutationAltered expression levelsChanged NDH:PSI stoichiometryModified response to environmental signals

For detailed functional analysis, researchers could employ:

  • Chlorophyll fluorescence measurements:

    • Monitor post-illumination fluorescence rise (a signature of NDH activity)

    • Measure non-photochemical quenching capacity

    • Assess electron transport rates under different light intensities

  • P700 absorbance changes:

    • Measure cyclic electron flow around PSI

    • Determine PSI redox state under various conditions

  • Electrochromic shift measurements:

    • Quantify proton motive force generation

    • Assess pmf partitioning (ΔpH versus ΔΨ)

These approaches would reveal how ndhG mutations specifically affect the plant's ability to optimize photosynthesis under variable environmental conditions and provide insights into the role of the NDH complex in photoprotection .

How can synthetic biology approaches be used to engineer optimized ndhG variants?

Synthetic biology offers innovative approaches to engineer ndhG variants with enhanced properties for basic research and potential biotechnological applications:

  • Rational design approaches:

    • Structure-guided mutagenesis based on homology models or crystal structures

    • Optimization of electron transfer pathways by modifying key residues

    • Enhancement of protein stability through computational design

  • Directed evolution strategies:

    • Development of selection systems based on photosynthetic fitness

    • Error-prone PCR to generate ndhG variant libraries

    • Screening for variants with improved stress tolerance or electron transfer efficiency

  • Domain swapping and chimeric proteins:

    • Creation of chimeric proteins combining domains from different species

    • Introduction of features from extremophile organisms for enhanced stability

    • Fusion of reporter domains for easier monitoring of complex assembly

  • Optimization for heterologous expression:

    • Codon optimization for expression in model organisms

    • Incorporation of solubility-enhancing tags

    • Co-expression with chaperones to improve folding

These synthetic biology approaches could yield ndhG variants with enhanced properties such as improved electron transfer rates, greater stability under stress conditions, or altered regulatory responses that might benefit both basic research and agricultural applications focused on improving photosynthetic efficiency .

What are the systems biology approaches to understand ndhG integration in the photosynthetic apparatus?

Understanding how ndhG functions within the broader context of photosynthesis requires integrative systems biology approaches that span multiple scales:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate ndhG expression with other components of electron transport

    • Identify metabolic signatures associated with NDH activity

  • Network analysis:

    • Construct gene regulatory networks controlling ndhG expression

    • Map protein-protein interaction networks for NDH complex assembly

    • Model metabolic networks affected by NDH activity

  • Flux balance analysis:

    • Quantify electron flow through different pathways

    • Model ATP:NADPH ratios under various conditions

    • Predict metabolic adjustments to altered NDH activity

  • Multi-scale modeling:

    • Integrate molecular dynamics of ndhG with electron transport kinetics

    • Link chloroplast-level processes to whole-plant physiology

    • Predict plant-level responses to environmental changes based on ndhG function

  • Comparative systems analysis:

    • Compare system-level organization between species with and without ndh genes

    • Identify compensatory mechanisms in species lacking NDH complex

This systems biology framework would provide a comprehensive understanding of how ndhG contributes to photosynthetic efficiency and stress responses within the complex network of interactions that characterize the photosynthetic apparatus .

How might climate change affect the selective pressure on ndhG function in natural populations?

Climate change presents novel selection pressures that may affect the evolution and function of ndh genes, including ndhG, in natural plant populations:

  • Temperature effects:

    • Increasing temperatures may enhance the protective role of the NDH complex against heat stress

    • Cyclic electron transport becomes more crucial at high temperatures to generate additional ATP

    • The NDH complex helps maintain photosynthetic efficiency during heat stress

  • Drought implications:

    • More frequent drought conditions may increase selection pressure for efficient NDH function

    • The NDH complex contributes to maintaining photosynthesis under water-limited conditions

    • Plants with optimized ndhG function may show enhanced drought resilience

  • CO₂ concentration impacts:

    • Rising atmospheric CO₂ may reduce photorespiration, altering ATP:NADPH demand

    • This could modify the selective advantage of NDH-mediated cyclic electron flow

    • Transgenic plants defective in ndh genes show impaired photosynthetic activity under high CO₂

  • Light pattern changes:

    • Altered cloud cover and canopy structures may change light fluctuation patterns

    • The NDH complex is particularly important under fluctuating light conditions

    • Selection may favor optimized ndhG variants that perform better under these conditions

Monitoring ndhG sequence evolution, RNA editing patterns, and expression levels in natural populations across climate gradients would provide valuable insights into ongoing adaptation processes and help predict future evolutionary trajectories in a changing climate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.